Research projects

Granted by ISCIII COVID-19 funds and other projects adhered to the ISCIII-COVID-19 Registry

The ISCIII granted research projects with the COVID-19 extraordinary fund to promote knowledge about SARS-CoV-2 and COVID-19 disease as well as its impact on infected people, with the aim of contributing to efficient patient treatment and/or public health preparedness and response. The expected impact is to:

The table will be updated with additional data regarding outcomes as they are supplied by ISCIII.

Last update: 2022-12-07
Funding call
Registro estatal de COVID19
Organisation
Unicentric
Multicentric
Clinical Trial
Yes
No
Topic call
Artificial intelligence
COVID-19 disease characterization
Diagnostics
Epidemiological surveillance
SARS-CoV-2 characterization
Socio-economic impact
Therapies
Vaccines
Download as CSV
Project Ref. ID Center Trial Organisation Topic call Funding call
Clinical-epidemiological study of coronavirus disease (COVID-19) in health centers: COVID-A study
Pedro Abizanda Soler
Servicio de Salud de Castilla-La Mancha (SESCAM)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Socio-economic impact
The objective is to carry out a clinical-epidemiological study as broad as possible in nursing homes in Albacete province to analyze the clinical, sociodemographic, functional, cognitive, nutritional and geriatric syndromes characteristics of the COVID-19, identify factors predisposing to infection and health outcomes specifics of this high-risk population. Initially, it will be held in the "Vasco Núñez de Balboa", "Paseo de La Cuba", "Vital Parque", "Alcabala" and "Alábega" nursing homes, although it could be expanded to other residences. In total, it is planned to include around 1,000 residents. A follow-up will be carried out at 3 and 6 months to collect clinical, epidemiological and economic outcome variables in collaboration with the Department of economic analysis of UCLM (Toledo). The study will be carried out at the Geriatrics Service of Albacete.
COV20/00004 Servicio de Salud de Castilla-La Mancha (SESCAM) No Multicentric Epidemiological surveillance, Socio-economic impact Registro
Pilot study to evaluate the efficacy and safety of mefloquine as prophylaxis in people exposed to the disease caused by the SARS-CoV-2 coronavirus (COVID-19) (MEFLOCOVID-19)
Félix Gutiérrez Rodero
Fundación para el Fomento de la Investigación Sanitaria y Biomédica de la Comunitat Valenciana (Fisabio)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The objective of this study is to determine the protective efficacy of mefloquine prophylaxis against placebo in close contacts of people with COVID-19. For this, 200 contacts of people in close contact with patients will be selected infected with COVID-19 and who will be randomly assigned to one or the other arm of the study and they must follow the indicated administration regimen (one tablet per week).
COV20/00005 Fundación para el Fomento de la Investigación Sanitaria y Biomédica de la Comunitat Valenciana (Fisabio) Yes Multicentric Therapies
Epidemiological record of pregnant women with COVID-19.
Óscar Martínez Pérez
Instituto de Investigación Sanitaria Puerta de Hierro-Segovia de Arana
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Spanish multicenter epidemiological study based on the registration of cases of pregnant women with COVID 19 in Spain. Objective: the knowledge of the influence of COVID 19 on gestations and childbirth in our country. 77 Associated centers at the time of preparing this document. Data protection law compliant database This is a prospective observational registry study of pregnant women suspected of having a SARS-CoV-2 infection at any time during pregnancy with positive test results for SARS-CoV -2. Follow-up up to two weeks after delivery. Start date March 2020. End March 2021 € 43,000 is requested to create its own database, exploit it and communicate the results.
COV20/00021 Instituto de Investigación Sanitaria Puerta de Hierro-Segovia de Arana No Multicentric Epidemiological surveillance Registro
Randomized clinical trial to evaluate the efficacy of different treatments in patients with COVID-19 who require hospitalization (PanCOVID19)
José Ramón Arribas
Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
There is an urgent need to evaluate commonly used drugs with potential efficacy for COVID-19. This protocol evaluates the efficacy of various antiviral treatments in patients with severe SARS-CoV-2 pneumonia regarding mortality, length of the hospital stays and reception of ventilation or intensive care. The study design is an open and randomized clinical trial, allowing to add / remove treatment arms while the trial is in progress. This study complements the Solidarity trial promoted by WHO and will provide additional and valuable information.
COV20/00023 Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid Yes Multicentric Therapies
Use of drugs that increase the expression of ACE2 and the risk of COVID-19: A case-population study
Francisco José de Abajo Iglesias
Fundación para la Investigación Biomédica del Hospital Universitario Príncipe de Asturias (HUPA)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
SARS-CoV-2 uses the angiotensin-2 converting enzyme (ACE2) to penetrate cells and replicate. Certain drugs are known to increase the expression of ACE2 and may facilitate the entry of the virus and promote the severity of the infection. We intend to conduct an epidemiological case-control study, taking as cases patients hospitalized by COVID-19 in participating hospitals (subclassified by severity) and primary care population controls extracted from the BIFAP database and paired with cases by age (exact), sex and index date. Information on prescribed drugs and comorbidities will be extracted from the hospital and BIFAP clinical records and the adjusted Odds Ratio will be computed using conditioned logistic regression models. Information from non-hospitalized mild COVID-19+ cases will be assessed as an alternative series of controls (1:1 ratio).
COV20/00027 Fundación para la Investigación Biomédica del Hospital Universitario Príncipe de Asturias (HUPA) No Unicentric Epidemiological surveillance Registro
Short, medium and long-term effect of COVID-19 disease on the cardiovascular system.
Salvatore Brugaletta
Instituto de Investigaciones Biomédicas August Pi I Sunyer (IDIBAPS)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Patients with COVID-19 disease have a very high risk of short and long-term cardiovascular adverse events, including death from cardiovascular causes. We propose an epidemiological surveillance study to determine the rate of adverse cardiovascular events (cardiovascular death, myocardial infarction, cardiovascular accident, cardiac arrhythmias) = at the time of infection, 30 days, 6 and 12 months, in patients confirmed by COVID- 19. In addition, to determine the relationship between the use of drugs that inhibit the angiotesin 2 converting enzyme, angiotesin 2 receptor blockers and non-steroidal anti-inflammatory drugs in the presentation of severe or fatal cases by COVID-19, through a case-control study. We will develop tools for early warning, prediction and risk stratification of cardiovascular adverse events in patients with COVID-19 Through a web page, immediate dissemination of the information generated and open use of the tools developed will be made.
COV20/00040 Instituto de Investigaciones Biomédicas August Pi I Sunyer (IDIBAPS) No Unicentric Epidemiological surveillance Registro
Therapeutic repositioning directed at inhibition of ACE2 expression and viral S-trimer proteolysis
Manuel Portero-Otin
Instituto de Investigación Biomédica de Lleida-Fundación Dr Pifarre (IRB Lleida)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
Various cell lines (eg Vero or Calu-3) express in their cell membrane the ACE2 protein, involved in the union with the S trimmer of SARS-CoV-2, and also has proteolytic activities for the activation of the same protein, two of the hypothetical requirements for the entry of the virus into a human host. Therefore, those substances that can diminish the role of ACE2 or the activity of proteases of the guest on protein S, could be used for the treatment of the infection. Thus, i) commercial drug libraries authorized for use in humans and ii) antisense oligonucleotides with peptide vehicles will be used as condidate molecules as a new therapeutic approach.
COV20/00047 Instituto de Investigación Biomédica de Lleida-Fundación Dr Pifarre (IRB Lleida) No Unicentric Therapies
Development of a vaccine against SARS-VOC-2 by means of muNS-Mi micro / nanospheres
José M. Martínez Costas
Universidad de Santiago de Compostela (USC)
Organization: Multicentric
Clinical trial: No
Topic call: Vaccines
We have developed and patented a methodology that allows to synthesise protein micro (MS) or nanospheres (NS) containing any protein of interest by tagging them with a tag called IC. These MS function as vaccines in the absence of adjuvants and the integrated proteins fold perfectly, allowing quaternary structures and even enzymatic reactions. In this project we intend to generate microspheres containing the S1 domain of protein S or the M or N proteins of SARS-Cov-2 and characterize in a mouse model the immune response they induce when administered intranasally or intramuscular. The methodology is already developed in the baculovirus expression systems, mammalian cells and bacteria, and will adapt to the yeast system for fast implementation in human vaccines.
COV20/00050 Universidad de Santiago de Compostela (USC) No Multicentric Vaccines
Identification of Mpro protease inhibitors of the COVID-19 virus by drug repositioning
Juan Jesus Perez Gonzalez
Universidad Politécnica de Cataluña (UPC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
The project aims to discover Mpro protease inhibitors of the SARS-CoV-2 virus by repositioning drugs as new antiviral agents. This will be done using computer-assisted drug design methods. The process includes the preparation of the target structure by molecular dynamics, molecular screening using a molecular anchorage algorithm and calculation of the free binding energy of the best ligands. Databases of molecules approved as therapeutic agents and natural products will be used for virtual screening. The final result will be an affinity sorted list of various molecules that can be tested in vitro.
COV20/00052 Universidad Politécnica de Cataluña (UPC) No Unicentric Therapies
Evaluation of epidemiological scenarios of COVID19 disease through an original model using membrane computing
Fernando Baquero
Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS)
Organization: Unicentric
Clinical trial: No
Topic call: Artificial intelligence
The aim is to apply our already recognised knowledge in the establishment of computer models based on new membrane computing techniques in order to develop a multi-parametric and multi-hierarchical model for the prediction of the effect of interventions on the COVID-19 epidemic. The model allows introducing ranges of values at multiple levels (e.g., ages, contact rates, contact times, transmission rates, transmission protection measures and effects of possible therapeutic agents) and observing how the modification of each or several factors simultaneously influences the epidemiological trend of the disease. The purpose is to assist in decision-making for the establishment of on-demand interventions for specific scenarios.
COV20/00067 Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS) No Unicentric Artificial intelligence
Pilot, randomized, multicenter, open-label clinical trial of combined use of hydroxychloroquine, azithromycin, and tocilizumab for the treatment of SARS-CoV-2 infection (COVID-19) (TCOVID)
Pere Domingo Pedrol
Institut de Recerca de l’Hospital de la Santa Creu i Sant Pau (IIB Sant Pau)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The main objective of the study is to evaluate in-hospital mortality, need for mechanical ventilation in Intensive Care Units, or need for rescue dose of tocilizumab in patients with confirmed infection by COVID-19 in treatment with hydroxychloroquine and azithromycin combined with non-tocilizumab. The study will compare 2 branches, standard of care, control branch; vs. tocilizumab treatment, experimental arm.
COV20/00070 Institut de Recerca de l’Hospital de la Santa Creu i Sant Pau (IIB Sant Pau) Yes Multicentric Therapies
Multi-center, Randomized Clinical Trial of Convalescent Plasma Therapy Versus Standard of Care for the Treatment of COVID-19 in Hospitalized Patients (ConPlas-19)
Cristina Avendaño Solá & Rafael Duarte Palomino
Instituto de Investigación Sanitaria Puerta de Hierro - Segovia de Arana
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
Convalescent plasma Therapy (PC, administration of fresh plasma from immunized donors) is used in viral acute respiratory infections. Given the SARS-CoV-2 pandemic, this study proposes to carry out a randomized trial in non-severe subjects hospitalized for COVID-19 with PC vs "standard of care" (according to WHO guidelines), in more than 20 hospitals, in coordination with the transfusion centres and the CNM-ISCIII. In this study, all participating patients will receive the standard treatment provided according to the current treatment protocols for coronavirus disease. In addition to this treatment, each patient will be randomly assigned to receive additional treatment with convalescent plasma transfusion (CP; blood plasma from patients who have been cured of coronavirus), or continue with standard treatment but without adding transfusion.
COV20/00072 Instituto de Investigación Sanitaria Puerta de Hierro - Segovia de Arana Yes Multicentric Therapies
Proof of Concept of fast detection method of SARS-CoV-2 contaminated surfaces using multispectral holographic and optical analysis with artificial intelligence.
Emilio Gómez González
Universidad de Sevilla (US)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Currently there are no methods to detect and visualize the presence of the SARS-CoV-2 on material surfaces. This project aims to design, develop and evaluate a prototype of a portable device (using existing optical technologies combined with artificial intelligence) for rapid and contactless detection of contaminated areas in surfaces. To do so, this project will: i) combine multispectral images in the optical range (ultraviolet to thermal infrared) and terahertz, ii) use optical analysis methods computational, interferometry and holography, iii) integrate information through intelligence artificial, and iv) carry out laboratory tests and in contaminated and clean environments.
COV20/00080 Universidad de Sevilla (US) No Unicentric Epidemiological surveillance
PsyCorona: a multinational initiative of urgent data collection with a longitudinal and prospective approach
Manuel Moyano Pacheco
Universidad de Córdoba (UC)
Organization: Multicentric
Clinical trial: No
Topic call: Socio-economic impact
We are conducting a rapid, multi-national collaboration that aims to identify psychological and cultural factors that may be relevant to the virus spread and its imminent social and material consequences. The online survey includes brief measures to assess topic-relevant beliefs, fears, hopes, and frustrations, predictors of self-containment and social distancing, attitudes toward policies, reasoning, and behavioral self-reports. The survey has a built-in longitudinal component as well as a broader data science mission involving metadata. This is an unfunded, citizen-scientist initiative comprised of 40+ colleagues (and counting). The goal of of group is to publish reports suggesting to policy makers the most promising avenues to thwart the spread of the virus.
COV20/00086 Universidad de Córdoba (UC) No Multicentric Socio-economic impact Registro
Sedation With Sevoflurane Versus Propofol in Patients With Acute Respiratory Distress Syndrome Caused by COVID19 Infection (SEVO-COVID19)
Rafael Badenes Quilés
Instituto de Investigación Sanitaria del Hospital Clínico de Valencia (INCLIVA)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The objective of this study is to evaluate the effect of 48-hour treatment with inhaled sevoflurane on arterial oxygenation, assessed by PaO2/FiO2 on day two, in patients with ARDS-CoVid19. The effects of sevoflurane on pro-inflammatory cytokine levels (Tumor Necrosis Factor [TNF] alpha, Alveolar and plasma IL-1beta, IL-6, IL-8) during ARDS-CoVid19 and the mortality at day 30 will also be addressed. It is a multicentre, national, randomized 1:1 ratio, controlled, parallel, open study. Patients in their first 24 hours of admission to the UCC and after being diagnosed with ARDS, they will be randomized to receive sevoflurane as a sedative or standard sedation with propofol.
COV20/00096 Instituto de Investigación Sanitaria del Hospital Clínico de Valencia (INCLIVA) Yes Multicentric Therapies
COVID-19 infection in HIV-infected patients included in CoRIS
Juan Berenguer
Instituto de Investigación Sanitaria Gregorio Marañón (IiSGM)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
To date, only anecdotal cases of COVID-19 have been described in HIV-infected persons. This supports the hypothesis that antiretroviral drugs may have some protective effect against SARS-CoV-2 infection. In order to have reliable information about the incidence of symptomatic or asymptomatic SARS-CoV-2 infection, we intend to carry out a retrospective study within the scope of the Spanish AIDS Research Network Cohort (CoRIS). Objectives: (i) to describe the frequency and epidemiological and clinical characteristics of patients with COVID-19 in CoRIS, as well as the prognostic factors of intensive care requirement, use of mechanical ventilation, duration of admission and mortality; and (ii) to study the prevalence of antibodies against SARS-CoV-2 by determining IgG and IgM antibodies by ELISA
COV20/00108 Instituto de Investigación Sanitaria Gregorio Marañón (IiSGM) No Multicentric COVID-19 disease characterization Registro
Risk factors, personalized prognosis and one-year follow-up of patients admitted to the Spanish Intensive Care Units infected with the SARS-CoV-2 virus (CIBERSESUCICOVID)
Antoni Torre Martí
Centro de Investigación Biomédica en Red, CIBER (Hospital Clinic, Barcelona)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The aim of this project is to determine the risk factors, prognosis and short and long-term outcomes (6 months and one year) of patients with COVID-19 admitted to Spanish ICUs. The second objective is the study of epigenetics and essential predictive enrichment biomarkers to help individualize treatment based on the altered biological pathways in each patient. The clinical data will be analysed with artificial intelligence.
COV20/00110 Centro de Investigación Biomédica en Red, CIBER (Hospital Clinic, Barcelona) No Multicentric Epidemiological surveillance Registro
Real-time quantification of new unreported cases of COVID-19 in Spain
David Moriña Soler
Consorci Centre de Recerca Matematica (CRM)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The proposed project aims to develop a set of mathematical models to quantify in real time the new unreported cases of COVID-19 in Spain, by Autonomous Communities or other areas of interest. The estimates provided by these models will be used to study the dynamics of the disease based on the application of compartmentalised epidemiological models (type SIR, SEIR, SIRS, etc.) that will make it possible to estimate, more precisely, the associated mortality and morbidity. Similarly, these estimates will be used to carry out an exhaustive analysis of the cost-effectiveness in different realistic action scenarios, both from the point of view of public management and from that of social management, which will be able to help in the decision-making process in the area of the national public health system and also within each Spanish Autonomous Community, in order to deal with the present pandemic and in future similar situations.
COV20/00115 Consorci Centre de Recerca Matematica (CRM) No Unicentric Epidemiological surveillance
Identification of the dynamic transcriptomic profile in patients with COVID-19 and acute respiratory distress syndrome (TRANSCOVID)
Jordi Carratalà Fernández
Fundación del Instituto de Investigación Biomédica de Bellvitge (Fundación IDIBELL)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
Although some clinical characteristics (advanced age, high fever, high SOFA score) and inflammatory response (IL-6, PC-R, D-dimer) have been described, the reasons why certain patients with COVID-19 develop severe disease, presenting dyspnea and hypoxemia in the first 7 days and rapid progression to ARDS, multi-organ failure and death, continue to be an enigma. The main objective of the present project is to determine the dynamic transcriptomic profile of adult patients hospitalized by COVID-19 and to characterize the subgroup that develops severe disease (ARDS). Secondary objectives are to establish a gene signature capable of basally discriminating the group that will develop ARDS and contribute to the phylogeny of the virus.
COV20/00121 Fundación del Instituto de Investigación Biomédica de Bellvitge (Fundación IDIBELL) No Unicentric COVID-19 disease characterization Registro
Development of colorimetric sensors based on gold nanoparticles for the detection of SARS-COV-2 (NANO COVID-19)
Rodolfo Miranda Soriano
Instituto Madrileño de Estudios Avanzados en Nanociencia (IMDEA)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
The project addresses the preparation of colorimetric sensors based on nanoparticles and oligonucleotides, which allow the detection of the virus by changing the colour of a solution, or the presence of colour in a nitrocellulose strip. The system will be implemented at 3 different amplification systems in order to reduce the use of highly specialized equipment and reagents to a minimum: 1) in RT-PCR, avoiding the use of quantitative RT-PCR, 2) in amplification isothermal, avoiding the use of PCR in general, and 3) in non-enzymatic amplification, avoiding the use of enzymes. The processes developed are industrially scalable, and are expected to acquire rapidly the ability at IMDEA Nanoscience to produce 5,000 sensors based on nanoparticles.
COV20/00122 Instituto Madrileño de Estudios Avanzados en Nanociencia (IMDEA) No Unicentric Diagnostics
Addressing unknowns of COVID-19 transmission and infection combining pathogen genomics and epidemiology to inform public health interventions
Iñaki Comas Espadas
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Artificial intelligence, Therapies, SARS-CoV-2 characterization
There is a growing pressure to understand the transmission patterns of SARS-CoV-2. As a new emergent virus, we have important gaps in the epidemiology of its infection. Those gaps translate also to limited understanding on who is infectious and for how long and how is connected to clinical outcome. Here we propose several objectives that involve combining viral genome data to epidemiological, clinical information to address those gaps. We will obtain viral complete genome sequences and epidemiological data and combine to (1) inform public health measures by revealing highways of transmission; (2) identify when an individual is infectious; (3) identify early warnings of local spread; (4) viral diversity connected to immune, drug and diagnostic; (5) complement current diagnostic approaches, and (6) identify the connection to adverse clinical outcomes. To this end, we have put together a nation-wide group of infectious disease, genomics, bioinformaticians and clinical researchers from more than 30 institutions.
COV20/00140 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Multicentric Epidemiological surveillance, Artificial intelligence, Therapies, SARS-CoV-2 characterization Registro
SARS-CoV2 Airbone Transmission: Innovative Technologies for virus detection in hospitals
Antonio Alcamí Pertejo
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
Airborne transmission of pathogens is a virtually unexplored area due to low concentration of microbial biomass in the air and the lack of sensitive tools for its study. The objective of the project is to study the transmission of SARS-CoV-2 by air in the hospital environment. For this we will use airborne virus capture equipment developed in A. Alcamí's laboratory and already installed in the Hospital La Paz to monitor the presence of SARS-CoV-2. To improve the studies of virus transmission, new faster and more sensitive detection methods will be developed than currently available methods and cutting-edge technologies to detect SARS-CoV2 in the air in real time. The project is structured in 3 objectives: (1) Monitor the prevalence of SARS-CoV2 in different hospital areas (ICU, wards waiting, emergency, rest staff, pediatrics, neonates) (2) Optimize the rapid detection of viruses, by using nanoparticles that identify Genomic RNA and viral proteins (3) Optimize the LIF (laser-induced fluorescence) methodology, a new technology that It will allow to identify SARS-CoV2 particles in real time in the air.
COV20/00144 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Diagnostics
Development of a vaccine, MVA-COVID-19, expressing SARS-CoV-2 antigens
Juan García Arriaza
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
Our objective is to produce an effective vaccine against SARS-CoV-2 as follows: Vaccine 1: This vaccine named MVA-COVID-19(S) will express the full-length S protein of SARS-CoV-2 and is directed to generate in an organism neutralizing antibodies to prevent infection and virus spread. This vaccine is ongoing in our laboratory and expected to have the candidate during April-May 2020 to be used for preclinical studies during June-July 2020. Vaccine 2: This vaccine named MVA-COVID-19(S-E-M) will express three proteins of SARS-CoV-2 (S, E and M) in the form of VLPs and is directed to trigger neutralizing antibodies and T cell (CD4+ and CD8+) immune responses, with the goal to produce long-term control of virus infection. This vaccine will be generated along May-September 2020 to initiate the preclinical studies in October-December 2020.
COV20/00151 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Vaccines
Early diagnosis of COVID-19 by isolation of exosomes in individuals suspected of the disease
Mª del Pilar Martín Duque
Instituto Aragonés de Ciencias de la Salud (IACS)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
Following WHO guidelines, it has been announced that new tests will soon be used much faster, but also more inaccurate diagnoses that can lead to false positives and negatives. In this sense, since genetic material of coronavirus has been found in serum exosomes and HIV-1 in exosomes of urine of infected persons here we suggest to perform, the diagnostic tests on the urine exosomes, plasma and saliva of patients at different times of the study, to detect it more reliably and early.
COV20/00155 Instituto Aragonés de Ciencias de la Salud (IACS) No Unicentric Diagnostics
NGS Analysis of the SARS-CoV2 outbreak at the Elche General Hospital
Antonio Galiana Cabrera
Fundación para el Fomento de la Investigación Sanitaria y Biomédica de la Comunitat Valenciana (Fisabio)
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
Molecular study using the NGS to obtain the genome sequences of the SARS-CoV-2 virus of the positive cases identified at the Elche General Hospital. With the data obtained, a molecular epidemiological analysis of the genetic variation of the virus in this Hospital from the beginning of the outbreak to the end of it can be carried out. In addition, these sequences will contribute to increase the genomic sequences of this virus in the global databases that will allow the realization of epidemiological studies at both national and global levels. With the information generated, the clinical data of patients affected by SARS-CoV-2, infection can be put into context and it will be possible to identify whether there is a relationship or a cluster of the virus with higher prevalence or worse prognosis in our Hospital.
COV20/00156 Fundación para el Fomento de la Investigación Sanitaria y Biomédica de la Comunitat Valenciana (Fisabio) No Unicentric SARS-CoV-2 characterization Registro
The neurological component of COVID-19. Does the Neuro-COVID-19 exist?
Pedro Jesus Serrano Castro / Fernando Rodriguez de Fonseca
Fundación para la investigación de Málaga en Biomedicina y Salud (FIMABIS)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The SARS-COV-2 coronavirus, similar to other viruses in the same family, has the ability to affect the nervous system. This neuroinvasive ability has been attributed a potential prognostic value because it is related to respiratory failure in infected patients. On the other hand, in a retrospective review of 214 cases attended during the epidemic outbreak in Wuhan, symptoms attributable to both CNS and PNS are described in a relevant percentage. Based on these data, we hypothesize that the neurological involvement in the acute phase and in the medium or long term may condition the prognosis and quality of life in patients who have survived the infection. The objective of this project is the clinical, biological and molecular characterization of neurological involvement in a prospective cohort of SARS-CoV-2 infection survivors.
COV20/00157 Fundación para la investigación de Málaga en Biomedicina y Salud (FIMABIS) No Unicentric COVID-19 disease characterization Registro
Search for immunological, prognostic and therapeutic markers in patients with COVID-19
Marcos López Hoyos
Instituto de investigación sanitaria Valdecilla (IDIVAL)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The aim of this project is to study the innate and acquired immune response in patients diagnosed with SARS-CoV-2, by monitoring the cellular and humoral components of the innate and adaptive immune response in blood and their correlation with clinical severity. This panel is similar to the one used in the clinical characterization of immunocompromised patients and can be applied immediately to the management of patients with COVID-19.
COV20/00170 Instituto de investigación sanitaria Valdecilla (IDIVAL) No Unicentric COVID-19 disease characterization Registro
Nanosensor-based diagnosis and rapid solution identification of SARS-COV-2 virus interaction with its cellular receptor (NANOCOMPETE)
Francisco García Cózar
Instituto de Investigación e Innovación Biomédica de Cádiz (INIBICA)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
There are few serological tests against SARS-CoV-2 and none that can be performed in solution. The proposed assay allows to detect antibodies (Ab) and / or virus from serum or plasma, without processing and to identify directly Abs that compete the virus / receptor interaction (according to affinity and epitope). It will also allow identifying patients that have Abs blocking the virus / receptor interaction (whose serum can be used in therapy). We will use samples from infected patients to identify coding sequences of variable regions of Abs with sufficient affinity to block the virus / receptor interaction and we will develop Chimeric antigen receptor (CAR) for the destruction of infected cells. We will also develop regulatory CARs to specifically block the immune system, in those cases where it is responsible but also, regulatory CARs to specifically block the immune system, in those cases where it is responsible of the pathogenesis of serious infections. Based on existing developments, we proposed the proof of concept of a nano sensor, which allows the analysis of samples and data collection by the general public using a smartphone.
COV20/00173 Instituto de Investigación e Innovación Biomédica de Cádiz (INIBICA) No Unicentric Diagnostics
STOP-Coronavirus: clinical, immunological, genomic, virological and bioethical factors of COVID-19
José María Aguado García
Instituto de Investigación Hospital 12 de Octubre (imas12)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The STOP-Coronavirus project aims to analyse in an integrated and multidisciplinary way the impact that various factors (clinical presentation, immunological markers, therapeutic strategies, host and virus genomics, and bioethical and socio-economic considerations) have on the evolution and prognosis of COVID-19. A prospective multicenter cohort of patients diagnosed with COVID-19 will be established. In parallel, the immune response to SARS-CoV-2, genetic markers of host susceptibility, the complexity of the SARS-CoV-2 mutant spectrum and the socio-economic and bioethical impact of COVID-19 will be characterized. Clinical analysis will be complemented by a nested cohort of immunosuppressed patients and by the assessment of COVID-19 response to antiviral and immunomodulatory treatment. Ultimately, this project will guide and individualize the clinical and therapeutic approach of COVID-19 and mitigate the health and social impact of the pandemic
COV20/00181 Instituto de Investigación Hospital 12 de Octubre (imas12) No Multicentric COVID-19 disease characterization Registro
An innovative therapy against Covid-19 based on circular RNAs
Juana Díez Antón
Universidad Pompeu Fabra (UPF)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
Given the speed with which we can sequence the genomes of new RNA viruses, developing therapies directed against them, rather than against viral proteins, would accelerate the development of efficient therapies. In this project, we will generate and validate, in cell culture and in mouse models, circular RNAs (cRNAs) that hybridize and interfere with essential structures of the SARS-CoV-2 genome and inactivate it. The selection of resistances is highly improbable given the conservation of the target sequences and the interference on several regions simultaneously. Our previous success with cRNAs that inhibit the replication of other RNA (+) viruses, and the existence of already clinical RNA-based therapies and nebulization delivery systems, support the feasibility of our proposal.
COV20/00183 Universidad Pompeu Fabra (UPF) No Unicentric Therapies
Gestation and COVID-19: clinical and microbiological study (GESTA-COVID19)
Anna Suy Franch
Fundación del Instituto de Investigación Vall d'Hebron (VHIR)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The main objective of this study is to describe the influence of pregnancy on COVID-19 infection, as well as the influence of COVID-19 (and its treatment) on pregnancy, the fetus and the newborn. It is a descriptive, longitudinal, observational, multicenter study involving 8 hospitals to be conducted between April 2020 and March 2021. An electronic data collection notebook (REDCap) will be designed where data will be entered anonymously. Pregnant women infected by SARS-CoV-2 will be included, microbiological samples will be collected and processed (PCR-SARS-CoV-2 in a deferred way) from the mother and newborn and clinical data related to the patient, the infection, her treatment and complications, pregnancy and complications, delivery and newborn.
COV20/00188 Fundación del Instituto de Investigación Vall d'Hebron (VHIR) No Multicentric Epidemiological surveillance Registro
Study of the immune response in nested cases in a cohort to assess the effect of antiretrovirals on the progression of SARS-CoV-2 coronavirus infection
Carolina Cubillos Zapata
Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
Patients infected with SARS-CoV-2 virus are characterized by a high degree of inflammation and dysregulation of the specific T response. We have found that the hypoxia and oxidative stress suffered by these patients activate the inflammation complex. This complex also has effects on pyroptosis and on the production of IFN type l. On the other hand, the inflammatory condition of the patient will directly condition the specific T-response. In short, understanding the inflammatory state in patients provides information relevant to the evolution of the pathology. This project proposes as an object to study the effect of drugs collected in this clinical trial in patients with COVID-19, in the activation of inflammation and its effect on inflammation and T-response. These data associated with patient evolution are crucial to classify responders and viral avoidance mechanisms.
COV20/00207 Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid No Unicentric COVID-19 disease characterization
Determination of the presence of SARS-CoV-2 in environmental samples and its potential indirect transmission
Pilar Domingo Calap
Universidad de Valencia (UV)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Although SARS-CoV-2 and other coronaviruses are primarily transmitted directly between individuals during epidemic phases, the permanence of the virus in the environment has the potential to cause new outbreaks despite mitigation efforts. SARS-CoV-2 was detected in hospital wastewater in China and it was shown that the viral particles could remain infective long enough to pose a risk. We will investigate the potential for environmental transmission of the virus under our country's specific conditions. To do this we will first focus on the analysis of wastewater treatment plants and the release of the virus via the gut. We will also study the stability of the virus, as well as its presence in other environments, such as common surfaces like plastics, stainless steel or glass. This will provide valuable information for the management of the epidemic.
COV20/00210 Universidad de Valencia (UV) No Multicentric Epidemiological surveillance
Study to identify cytokine profiles capable of predicting the development of ARDS
Jesus Garcia-Donas Jimenez
Fundación de Investigación HM Hospitales
Organization: Multicentric
Clinical trial: No
Topic call: Diagnostics
The present study aims to identify an early marker in blood that will allow the anticipation of the developmentof ARDS in patients with COVID-19. We will perform, for a week, daily blood draws on a cohort of 100 patients currently admitted to the Hospital HM Sanchinarro with confirmed or suspected diagnosis of COVID-19. In these samples we will determine a broad cytokine panel (LUMINEX) correlating, in a prospective way, the analytical results with the development of severe ARDS. Using computer algorithms we will establish the determinations that best predict the appearance of this complication. The analysis will focus on proteins included in the portfolio of commercial companies that produce, on an industrial scale, diagnostic kits by ELISA. Thus, the markers found will be immediately available in any health care center in the country. In parallel, we will study the interindividual genetic variability and the evolution of viral load in these cases. In a second phase we will develop more precise and patentable multiplex kits.
COV20/00211 Fundación de Investigación HM Hospitales No Multicentric Diagnostics Registro
Preclinical development of innovative mRNA/MVAvaccines against SARS-CoV2
Felipe García
Instituto de Investigaciones Biomédicas August Pi I Sunyer (IDIBAPS)
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
The purpose of this project is to design and test in preclinical studies a new vaccine against SARS-CoV-2. The overall objective: 1. In a first step, to test a new mRNA vaccine candidate encoding SARS-CoV-2 epitopes selected through a bioinformatic approach and co-formulated with nanoparticles (mRNA-CoV2) in vitro and in vivo to assess the potential to induce SARS-CoV-2-specific immune responses. 2. In a second step, to test if a prime-boost strategy with mRNA-CoV-2 prime and MVA-CoV2 boost induce higher immune responses as compared with mRNA-CoV2 alone.
COV20/00214 Instituto de Investigaciones Biomédicas August Pi I Sunyer (IDIBAPS) No Unicentric Vaccines
SARS-CoV-2 infection in patients with Inflammatory bowel disease (COVID-19-EII)
Maria Esteve y Yamile Zabana
Fundació Docència i Recerca Mutua Terrassa
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The objectives of the COVID-19-EII study are 1) to describe the incidence and characteristics of SARS-CoV-2 infection in the ENEIDA cohort of IBD patients during the epidemic period and 2) to understand the course of the disease and its immunosuppressive and comorbidity treatment.
COV20/00227 Fundació Docència i Recerca Mutua Terrassa No Multicentric Epidemiological surveillance Registro
Study of the Microbiome and Virome associated with COVID-19
Juan Carlos Rodríguez Díaz
Instituto de Investigación Sanitaria y Biomédica de Alicante (ISABIAL)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance, COVID-19 disease characterization
Infection with SARS-CoV-2 virus ranges from asymptomatic forms to very severe bilateral pneumonias that often result in the death of the patient. Microbiome and virome are altered in a large number of pathologies, but their involvement in this process is unknown, although it is possible that both are involved in the different clinical severity of the patient. Therefore, the study of the microbiome and the virome should be carried out by means of a bioinformatic and statistical analysis of the microbial diversity and the taxa present in each of the samples, in order to identify biomarkers of severity of the process that can be used in the best management of the patient.
COV20/00236 Instituto de Investigación Sanitaria y Biomédica de Alicante (ISABIAL) No Unicentric Epidemiological surveillance, COVID-19 disease characterization Registro
SARS-CoV-2 biosecurity vaccine development platforms
David Escors Murugarren
Fundación Miguel Servet (Navarrabiomed)
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
A SARS-CoV-2 biosecurity vaccine engineering platform will be established, which includes three production procedures. The first will use human cells that secrete virus-like particles (VLPs), through the constitutive expression of SARS-CoV-2 proteins S, M and E. The second will use baculoviral vectors for the expression of these genes on a large scale and to compare the production of VLPs. The third procedure will be based on the production of non-replicative and non-integrative lentiviral particles, pseudotyped with the SARS-CoV-2 protein S and expressing the rest of the structural proteins. These particles will deliver the B and T epitopes to the immune system in a VLP format. BIRB796 will be incorporated into the vaccine preparations to enhance the human T response, since it is a MAPK p38 inhibitor approved for human use and with anti-senescent properties in lymphocytes.
COV20/00237 Fundación Miguel Servet (Navarrabiomed) No Unicentric Vaccines
ACE2-ORG: Development of a human cellular platform unveiling Angiotensin-converting enzyme 2 (ACE2)-SARS-CoV-2 interactions
Nuria Montserrat Pulido
Fundación del Instituto de Bioingeniería de Cataluña (IBEC)
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
There are no models allowing to unveil the molecular pathways and cellular responses differently regulated upon SARS-CoV-2 infection in human tissues. Organoid technology represents an affordable solution to COVID-19 research. Our consortia is able to infect a plethora of human organoids opening the door for drug screening for COVID19 treatment. These results are part of a present manuscript under review in Cell. Based in our current findings our aim is to understand, identify and target ACE2-SARS-CoV-2 cellular responses exploiting kidney and heart organoids exposed to systemic conditions worsening COVID19 disease (i.e., Diabetes). Using seRNA sequentiation we will unveil unique and common cellular responses upon SARS-CoV-2 infection and use primary cell cultures and retrospective COVID19 necropsies for validation. This approach will identify top ranked pathways differentially regulated upon SARS-CoV-2 infection in control and diabetic backgrounds.
COV20/00278 Fundación del Instituto de Bioingeniería de Cataluña (IBEC) No Unicentric SARS-CoV-2 characterization
Quick Detection and Characterization of COVID-19 on the patient
Felipe J. Chaves Martínez
Instituto de Investigación Sanitaria del Hospital Clínico de Valencia (INCLIVA)
Organization: Multicentric
Clinical trial: No
Topic call: Diagnostics, COVID-19 disease characterization
The biological cycle of coronaviruses allows the differentiation between the encapsulated virus and its infection and replication processes. We will develop modular kits that allow on the one hand to determine the presence of the virus and on the other the presence of viral processes involved in the infection and the determination of those variables that may be relevant in the development of the disease (viral and human). The kits will be based on isothermal amplification and by rapid PCR of the regions of interest and their rapid detection (15-30 minutes the presence of the virus, available in 1 - 2 months). In a second kit-module, from these amplified and those of interest in relation to the patient, will be generated libraries to be sequenced using Nanopore systems. This second part of the study will allow know the virus strain and the patient variables that are relevant to the disease, performing a report based on the available data and including other clinical variables of interest.
COV20/00279 Instituto de Investigación Sanitaria del Hospital Clínico de Valencia (INCLIVA) No Multicentric Diagnostics, COVID-19 disease characterization
Hydroxychloroquine efficacy in preventing SARS-CoV-2 infection and CoVid-19 disease severity during pregnancy (COVID-PREG)
Clara Menéndez Santos
Fundación Privada del Instituto de Salud Global de Barcelona (ISGlobal)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
This trial aims to assess the effect of hydroxychloroquine (HCQ) in reducing viral load and preventing SARS-CoV-2 infection in pregnant women. The proposed clinical trial will help improving the care and reduce the risk of poor pregnancy outcomes of women infected with SARS-CoV-2 in this and in future epidemics. By reducing the viral load of infected pregnant women, this trial will also have an impact on the reduction of the spread of the virus, both vertical and horizontal transmission. As the results from other trials testing the hydroxychloroquine (HCQ) may not be extrapolated to pregnant women given the special features of the pregnancy status, this clinical research is urgently needed.
COV20/00286 Fundación Privada del Instituto de Salud Global de Barcelona (ISGlobal) Yes Multicentric Therapies
An Efficient Peptide Vector for mRNA Vaccination Against COVID19
Javier Montenegro García
Universidad de Santiago de Compostela (USC)
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
In the race to find a COVID-19 vaccine, gene-based approaches are the leading choice with some already ongoing clinical trials. However, the major challenge of this technology is the extreme sensitivity and the very low cellular uptake of the gene material that triggers the hosts' immune response, which hampers their potential. To overcome this limitation, we have developed a synthetic platform for the rapid screening of peptide amphiphiles with potential as gene delivery vehicles. The application of this approach allowed the identification of a candidate with a remarkable (one order of magnitude in vitro) improvement in delivery efficiency and cellular toxicity compared to typical commercial reagents. Remarkably, this candidate has also recently proven highly active for in vivo delivery of mRNA in mice, which suggests that it can be an excellent non-viral vector for the formulation of mRNA vaccines with a boosted potency, due to the uptake enhancement provided by this conceptually-new delivery vector.
COV20/00297 Universidad de Santiago de Compostela (USC) No Unicentric Vaccines
Analysis of soluble markers of immune activation and CD8 NK and T cell populations in patients with SARS-CoV-2 infection
Julián Pardo, José Ramón Paño Pardo
Instituto de Investigación Sanitaria de Aragón (IISA)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, SARS-CoV-2 characterization
This study aims to generate knowledge about the populations of immune cells responsible for infection control, in order to understand the kinetics and magnitude of the immune response during COVID-19 disease. This knowledge can identify biomarkers that contribute to: 1) identifying which patients are most likely to experience respiratory failure requiring admission and respiratory support treatment in intensive care units, 2) monitoring the evolution of the infection and 3) exploring new therapeutic interventions. All of this not only seeks to contribute to the personalised treatment according to the profile and immunological response of each patient, but it will also reduce the stress on the health system by being able to predict in advance which patients may develop more serious clinical pictures and therefore plan and optimize the use of the resources available by the health system.
COV20/00308 Instituto de Investigación Sanitaria de Aragón (IISA) No Unicentric COVID-19 disease characterization, SARS-CoV-2 characterization Registro
Ultrasound monitoring in pregnant women with COVID-19 infection. Risks associated with severe infection and the trimester of pregnancy.
Marta López Rojano
Instituto de Investigaciones Biomédicas August Pi i Sunyer (IDIBAPS)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The implications of the COVID-19 pandemic on pregnancy are not well known. Severe maternal infection may be associated with premature delivery or impaired fetal growth. Maternal hypoxia could have consequences on neurodevelopment and on the fetal heart. On the other hand, there are no data on the impact of COVID-19 infection by trimester. Our aim is to analyze the perinatal outcome and the risk of growth retardation, abnormalities at the level of neurosonography or fetal echocardiography in women with COVID-19, as well as associated factors (severe maternal infection, hypoxemia, gestational age at infection). The expected results can be very useful in advising on possible fetal risks, improving the care and experience of pregnancy.
COV20/00310 Instituto de Investigaciones Biomédicas August Pi i Sunyer (IDIBAPS) No Multicentric COVID-19 disease characterization Registro
Immunosenescence as a risk factor for SARS-CoV-2 infection
David Otaegui / Alvaro Prada
Instituto de Investigación Sanitaria Biodonostia (IIS Biodonostia)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
In this project we intend to make a rapid approach to the state of lymphocyte populations and the inflammation process in COVID-19 positive patients with and without symptoms versus COVID-19 negative patients. With the hypothesis that immunosenescence is playing a role in the susceptibility to be infected, the studies will be performed in different age ranges (30-40 / 40-50 /50-60 / over 60). In the case of COVID-19 positive patients, immunosenescence and inflammation profiles at the time of diagnosis will be correlated with the clinical variables of monitoring the disease in search of prognostic markers in the evolution.
COV20/00314 Instituto de Investigación Sanitaria Biodonostia (IIS Biodonostia) No Unicentric COVID-19 disease characterization Registro
Functional characterization of SARS-CoV-2-specific T and B cell long-lasting Immunity in immunocompetent and immunosuppressed patients developing SARS-CoV-2 infection (COV-Immunity)
Oriol Bestard Matamoros
Instituto de Investigación Biomédica de Bellvitge (IDIBELL)
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
In this project we will investigate, using highly sensitive immune assays, the development of short and long-lasting immunity, both humoral and cellular, specific against SARS-CoV-2, at the time of infection and at different time points afterwards up to 24 months in previously healthy individuals, patients with relevant co-morbidities, solid organ transplant patients receiving chronic immunosuppression and patients with malignancies receiving chemotherapy.
COV20/00324 Instituto de Investigación Biomédica de Bellvitge (IDIBELL) No Unicentric SARS-CoV-2 characterization Registro
Exploiting protective immune responses to COVID-19 to unravel mechanisms associated with favorable clinical outcomes (PROTECTIVE STUDY)
Sergio Serrano-Villar
Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
Because COVID19 spectrum of disease range from asymptomatic disease to severe lung injury leading to death, we aim to exploit extreme clinical phenotypes of COVID-19 disease to identify mechanisms that can be leveraged to improve outcomes and to identify predictors of adverse outcomes. Because the clear correlation between clinical outcomes and age, we plan to recruit individuals across a broad range of age, including pediatric populations, reflecting the broad range of COVID19 disease severity. We will interrogate targeted biological pathways (i.e., ACE2 expression and polymorphisms, antiviral responses and innate and adaptive immunity) and untargeted pathways using plasma metabolomics and enzymolomics. These parameters will be correlated with the clinical phenotype and with virologic measures of CoVID19 using multiparametric data integration through a bioinformatic approach.
COV20/00349 Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS) No Unicentric COVID-19 disease characterization Registro
COVID-9 prevalence in patients with chronic inflammatory arthritis under treatment
Sara Marsal Barril
Fundación del Instituto de Investigación Vall d'Hebron (VHIR)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies, Epidemiological surveillance
Patients with chronic inflammatory arthritis (CIA) have an increased risk of infections due to both dysregulation of the immune system and immunosuppressive treatment. Preliminary evidence in our service indicates a lower rate of transmission by SARS-CoV-2 in patients with CIA receiving immunosuppressive treatment than that reported for the general population (<1%). This is a cross-sectional study of a very well-characterized cohort of N = 1,175 patients with CIA receiving treatment with selective immunosuppressants (ISS), both adult and pediatric, followed systematically in a third-level university hospital. Epidemiological and clinical data will be obtained from the electronic clinical history, the shared clinical history of Catalonia and through a telephone survey. The prevalence and clinical expression of COVID-19 in these patients will be determined, which will allow establishing clinical practice recommendations with great scientific and social impact.
COV20/00357 Fundación del Instituto de Investigación Vall d'Hebron (VHIR) No Unicentric Therapies, Epidemiological surveillance Registro
Multicenter study of coronavirus disease 2019 (COVID-2019) in Solid Organ Transplant Recipients
Maria Elisa Cordero Matia
Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
No information exists regarding COVID-19 in solid organ transplant recipients (SOTR). Besides, treatment is challenging as drug interactions might have an important impact on drug toxicity, graft dysfunction and rejection and probably outcome is adverse. No specific recommendations regarding COVID-19 exist. Objectives: to better understand the incidence, risk factors, clinical manifestations and outcome of COVID19 in SOTR. The results obtained will allow us to gain insight on the need of antiviral treatment, on the strategy for complications surveillance, on how to adjust the immunosuppressant therapy and on the level of care in which each patient should be treated. Design: Multicenter prospective study of consecutive cases of COVID-19 in SOTR. There will be a clinical follow-up of the patients included in this study to observe possible complications and survival rate.
COV20/00370 Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI) No Multicentric COVID-19 disease characterization Registro
SARS-CoV-2 Inhibition, Host Selection and Next-Move Prediction Through High-Performance Computing.
Modesto Orozco
Fundación del Institut de Recerca Biomédica (IRB Barcelona)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies, SARS-CoV-2 characterization, Epidemiological surveillance
We will fight SARS-CoV2 by using massive high-performance computing. Thanks to the recently published X-Ray structures, we will unveil the physico-chemical properties of the viral spike protein, those of the human ACE2 receptor and those of the complex they form to permit virus to infect cells and spread. This information, well implemented with knowledge-based bioinformatics techniques, will help us to understand the mechanism of viral entrance into the cell and what are the "next evolutionary moves" of the CoV family. Unbiased tajectories along with extensive free-energy calculation would help to identify new "druggable spots" (not detectable by crystallography). On this knowledge, we will start a drug discovery effort (of commercially available drugs first) to inhibit the interaction between the virus and the human host, hence impeding virus internalization and spread.
COV20/00373 Fundación del Institut de Recerca Biomédica (IRB Barcelona) No Unicentric Therapies, SARS-CoV-2 characterization, Epidemiological surveillance
Role of NK cells in susceptibility and prognosis of SARS-CoV2 infection (COVID-19)
Enrique Bernal Morell
Fundación para la Formación e Investigación Sanitarias de la Región de Murcia (FFIS)
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
The project investigates the role of NK cells in the susceptibility and prognosis of SARS-CoV-2 infection (COVID-19). In patients with mild (n=100) and severe (n=100) disease, the genotype (PCR-SSO-Luminex) and expression in NK cells (12-fluorescence cytometry) of KIR/ligand HLA-I interactions that regulate the education and function of these cells and determine their effectiveness against viral infections will be analysed. The data will be compared with 600 healthy controls of known genotype. The results will help to optimize health resources and avoid collapse by facilitating: 1) increased protection efforts in more susceptible people (health professionals, law enforcement, families of patients, etc.); and 2) anticipate anti-viral and anti-inflammatory therapies to the appearance of the most severe symptoms in susceptible patients.
COV20/00377 Fundación para la Formación e Investigación Sanitarias de la Región de Murcia (FFIS) No Unicentric SARS-CoV-2 characterization Registro
Derivation and validation of a prognostic scale in COVID-19 pneumonia. National multicenter study.
Rosario Menéndez Villanueva
Instituto de Investigación Sanitaria La Fe (IIS La Fe)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Artificial intelligence
COVID-19 disease challenges the capacity of national health systems. The course of the disease differs from other pneumonias known to date. The main objective of this project is to derive and validate a prognostic score (COVID-19) Severity Index [CSI] from a multicenter database on patients with COVID-19 pneumonia with prognostic variables of severity at admission to predict ICU requirement and death. A retrospective, multicenter study of adult patients with COVID-19 pneumonia requiring hospitalization in hospitals throughout Spain will be conducted (it is estimated that some 4,000 pneumonias will be recruited).
COV20/00385 Instituto de Investigación Sanitaria La Fe (IIS La Fe) No Multicentric COVID-19 disease characterization, Artificial intelligence Registro
Impact of monoclonal B-lymphocytosis and the state of the immune system on the development and evolution of COVID-19 infection in adults
José Alberto Orfao de Matos Correia e Vale
Instituto de Investigación Biomédica de Salamanca (IECSCYL-IBSAL)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
In this project we hypothesize that patients infected with SARS-CoV-2 virus who are carriers of an aging immune system, determined by the presence of small clones of B cells circulating in peripheral blood and the secondary immunodeficiency associated with this condition, would develop a more severe disease and would evolve worse due to their inability to recognize new antigens. To this end, we propose: 1) to explore the presence of B-lymphoid clones (LBMlo) in the blood of infected patients admitted to the Hospital Universitario de Salamanca; 2) to study the status of their immune system, using innovative tools developed by the research group that allow the identification in blood of >250 different populations of immune cells; 3) to relate the above data with the clinical characteristics of the patients; and 4) to identify parameters related to an aging immune system that will provide a solid basis for prognostic stratification and clinical validation.
COV20/00386 Instituto de Investigación Biomédica de Salamanca (IECSCYL-IBSAL) No Unicentric COVID-19 disease characterization Registro
COVID-19, immunological risk profile (attached to the project presented by VHIR IP R Pujol-Borrell)
Aina Teniente Serra
Fundación del Instituto de Investigación Germans Trias I Pujol (IGTP)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
It is currently unknown whether the minority of poorly progressing cases of COVID-19 are due to an excess or defect in the innate or adaptive immune response or to joint dysregulation. There are tools not yet applied to be able to discern between the various immunological scenarios in which this infection develops. Objective: To generate algorithms to stratify patients according to the immunological risk profile applicable to the analysis of clinical trials with immunomodulars in progress or in the future and, specifically, to support therapeutic strategies. Modules 1) daily collection and analysis of parameters of inflammation, coagulation, immunology and microbiology as well as biochemistry in relation to the origins of the samples and the demographic data of the patients, evolutionary follow-up and progressive assessment of the most predictive indices; 2) Measurement in 120 patients of the level of 18 cytokines and 32 lymphocyte populations; 3) Generation of prognostic algorithm and therapeutic orientation; 4) Identification of activated response pathways. Support modules include generating sample collections, clinical data extraction, and statistical analysis.
COV20/00388 Fundación del Instituto de Investigación Germans Trias I Pujol (IGTP) No Multicentric Epidemiological surveillance Registro
A prospective, multicenter, randomized, parallel, double-blind, placebo-controlled phase IIb clinical trial to evaluate intravenous infusion of Defibrotide in the prevention and treatment of respiratory distress and cytokine release syndrome in patients with COVID-19. (DEFACOVID)
Jose M. Moraleda Jiménez
Instituto Murciano de Investigación Biosanitaria Virgen de la Arrixaca (IMIB)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The aim of this project is to determine the efficacy of the intravenous infusion of Defibrotide to reduce mortality in patients with SARS-CoV-2 infection with clinical status grade 4 (Hospitalized patients requiring oxygen therapy), grade 5 (Hospitalized patients requiring high-flow oxygen therapy, non-invasive mechanical ventilation, or both) or grade 6 (Hospitalized patients requiring extracorporeal membrane oxygenation or invasive mechanical ventilation), according to the WHO classification.
COV20/00399 Instituto Murciano de Investigación Biosanitaria Virgen de la Arrixaca (IMIB) Yes Multicentric Therapies
Residual pulmonary fibrosis and lung capacity in survivors of SARS-CoV-2
José Ramón Blanco Ramos
Fundación Rioja Salud
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
After the epidemic of severe acute respiratory syndrome due to coronavirus (SARS-CoV), many of the people who survived developed residual pulmonary fibrosis (PF). Autopsies of these COVID-19 patients showed the presence of pulmonary fibrosis at different stages of infection. Risk of PF was highest in the elderly, and was correlated with clinical severity and duration of disease. On the other hand, dysregulation of the inflammatory response was observed in lung biopsies, with levels of certain proinflammatory cytokines in serum being especially elevated. Also, infection SARS-CoV-2 induces overactivation of the TGF pathway leading to pulmonary fibrosis. The goals of this projects are: 1) to improve the knowledge about the physiopathology of SARS-CoV-2; 2) to determine if in the people infected with SARS-CoV-2 who required admission for further lung damage persists a "inflammatory microenvironment" that could lead to residual lung injury, 3) assess the correlation between expression of cytokines, chemokines and serum/sputum growth factors and the respiratory function tests and the walking test.
COV20/00401 Fundación Rioja Salud No Multicentric COVID-19 disease characterization Registro
Prognosis of patients infected with the new SARS-CoV-2 coronavirus
Francisco Gude Sampedro
Fundación del Instituto de Investigación Sanitaria de Santiago de Compostela (IDIS)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
Approximately 14% of patients infected with SARS-CoV-2 present severe clinical symptoms and 5% require critical care, causing an overload on the health system. In this context, the use of predictive models to identify the most vulnerable subjects becomes a priority objective. Using data collected from electronic health records, this project aims to: 1) build survival and classification algorithms to estimate patient risk; and 2) based on the treatments administered to the patients, using causal inference models, quantifying the effectiveness of the drugs according to the characteristics of the patients.
COV20/00404 Fundación del Instituto de Investigación Sanitaria de Santiago de Compostela (IDIS) No Multicentric COVID-19 disease characterization Registro
COVID-19, immune risk profile (attached to 00654 project)
Ricardo Pujol Borrell
Fundación del Instituto de Investigación Vall d'Hebron (VHIR)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
It is currently not known whether the minority of poorly evolving cases of COVID-19 are due to an excess or defect in the innate or adaptive immune response or to joint dysregulation. There are tools not yet applied to be able to discern between the various immunological/virological scenarios in which this infection develops. The objective of this project is to generate algorithms/indices to stratify patients by the immunological/virological risk profile applicable to the analysis of ongoing or future clinical trials with immunomodulators. Methods: 1) Capture of parameters of inflammation, coagulation, immunology and microbiology as well as general analysis in relation to the origins of the samples, demographic data and clinical evolution; 2) Measurement in 120 patients of the level of 16 cytokines and 32 lymphocyte populations for: 3) the generation of prognostic and therapeutic orientation algorithms from 2; 4) detailed identification by Nanostring® transcriptomics of the immune response pathways activated in 40 patients and thus confirm/improve the algorithm generated in 3.
COV20/00416 Fundación del Instituto de Investigación Vall d'Hebron (VHIR) No Multicentric COVID-19 disease characterization Registro
COVID-19 in patients with heart failure and family heart disease
Juan Ramón Gimeno Blanes
Fundación para la formación e investigación sanitarias de la región de Murcia (FFIS)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence
An online platform will be created to register cases of patients with previous heart failure or family heart disease in which SARS-CoV-19 infection is confirmed. It will be an anonymized registry that will be accessed with a username and password through the web and will include basic demographic data, previous diagnoses, symptoms, previous treatments and during the episode, necessary interventions during admission and events. A common database will be generated from which the grouped data can be displayed and the corresponding statistical analyzes performed. The data will be available from the beginning of the project to the health authorities and to the participants in the registry. The registry will remain active for at least 2 years in order to collect data retrospectively from patients under previous follow-up in consultations, and to incorporate information on evolution and complications in the short and medium term.
COV20/00420 Fundación para la formación e investigación sanitarias de la región de Murcia (FFIS) No Multicentric COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence Registro
Epidemiological study and clinical-molecular implications of angiotensin in the prognosis of SARS-Cov-2 infection
Maria Sonia Gaztambide Saénz
Instituto de Investigación Sanitaria Biocruces Bizkaia (IIS Biocruces)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence
The aim is to establish the association and impact between COVID-19 infection and chronic treatment with ACEI or ARAII, in terms of a torpid-fatal clinical course. These drugs increase the expression of ACE2, the vehicle of entry to target cells in acute respiratory syndrome by SARS CoV-2. The aim is to establish the relationship between viral load and genetic predisposition by identifying polymorphisms and their expression linked to this enzyme, related to diseases such as: diabetes, hypertension, and stroke and their treatments; trying to develop clinical trials to identify more efficient therapies in a population with high mortality.
COV20/00421 Instituto de Investigación Sanitaria Biocruces Bizkaia (IIS Biocruces) No Unicentric COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence Registro
Interaction between SARS-CoV-2 and the human respiratory epithelium: sequestration of endocytosis and exocytosis pathways
José María Carvajal González
Universidad de Extremadura
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
The pathways of a pathogen into our body is based on the breakdown of our physiological barriers. In In the case of the respiratory tract, the epithelium is one of the first barriers that the human body presents. The viral transfer of This epithelium has two alternatives: 1) the paracellular space, which would involve disassembling the tight junctions and adherents between neighboring cells, and 2) performing an intracellular transport process, taking the virus for their benefit intracellular traffic routes. This project aims to 1 study how the virus enters our body through the epithelial cells of the human airways. On the other hand the release of new viruses to the lumen of the pathways Respiratory may be due to virus exocytosis. This process would require the use of the secretory pathways they use. cells naturally. This project in its objective 2 will study the exocytosis of SARS-CoV2 in epithelial cells of the human airways. In addition, the development of Objective 1 and 2 will conclude with the development of two platforms for screening, allowing to search for drugs that block the entry or exit of the virus directly into epithelia of the respiratory tract.
COV20/00429 Universidad de Extremadura No Unicentric SARS-CoV-2 characterization
Decoy-ACE2: Use of catalytically inactivated soluble ACE2 as an anti-COVID-19 drug.
Alberto Marina Moreno / Vicente Rubio Zamora
Centro de Investigación Biomédica en Red, CIBER (Hospital Clinic, Barcelona)
Organization: Multicentric
Clinical trial: No
Topic call: Therapies
We seek to inhibit the cellular entry of the coronavirus by administering large amounts of soluble (non-cell bound) viral receptor (ACE2) to act as a "decoy". We will inactivate by directed mutagenesis the carboxypeptidase activity of ACE2, without removing the catalytic Zn2+ with possible structural functions and without interfering with the stability of the protein or its interaction with the viral spicule, and we will produce it using baculovirus/insect cells (system that we use routinely). We will purify wild or mutant ACE2 by affinity chromatography exploiting an artificial eliminable label. We will prove that the mutant forms of ACE2 are catalytically inactive, stable, and that they bind to the binding region of the viral protein S. We will evaluate in cell cultures (collaboration with Jesús Rodríguez Díaz, Dept. of Microbiology, Hospital Clínico-University of Valencia) the potency of the mutated forms to inhibit the infection of viral inocula. We will determine (crystallography or cryoEM) structures of ACE mutant complexes/S binding domain.
COV20/00437 Centro de Investigación Biomédica en Red, CIBER (Hospital Clinic, Barcelona) No Multicentric Therapies
Clinical characterization of COVID-19 infection: Prognostic stratification and complications
Susana García Gutiérrez
Asociación del Instituto de Investigación en Servicios de Salud-Kronikgune
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence
Objectives: 1.-Create risk stratification scales for poor evolution of patients infected with SARS-CoV-19, and evolutionary profile of patients; 2.-Assess effectiveness of treatment and diagnostic tests; 3-Evaluation of accessibility, equity, variability and costs. Methods: Information extracted manually / automatically from the electronic medical history of parameters such as epidemiological history, onset of symptoms, clinical manifestations, tests performed, treatments and evolution up to 3 months after discharge. Statistical analysis: using classic survival models, logistic regression, generalized linear models, and also analysis using artificial intelligence techniques that assess the risk of poor evolution. Health care costs are valued. Decision making applications will be derived as a product.
COV20/00459 Asociación del Instituto de Investigación en Servicios de Salud-Kronikgune No Multicentric COVID-19 disease characterization, Epidemiological surveillance, Artificial intelligence Registro
Effect of drug consumption before and during SARS-COV-2 infection on the evolution of patients with COVID-19. A population-based cohort study
Adolfo Figueiras Guzmán
Fundación del Instituto de Investigación Sanitaria de Santiago de Compostela (IDIS)
Organization: Multicentric
Clinical trial: No
Topic call: Artificial intelligence
There are significant inconsistencies and lack of evidence on the effect of treatment with antihypertensive drugs of the ACEI and / or ARAII type and some NSAIDs and this could be a risk factor for severity and even mortality due to COVID-19. This favors rumors and errors in information, which can negatively affect Public Health and decision-making. Therefore, with this study we intend to assess whether previous consumption of certain medications (ACE inhibitors, ARAII) conditions a greater susceptibility to SARS-CoV-2 infection; and to identify those treatments received before and after infection that are associated with a better evolution and greater survival. For this, population records from Galicia will be used, using the HEXIN big data platform.
COV20/00470 Fundación del Instituto de Investigación Sanitaria de Santiago de Compostela (IDIS) No Multicentric Artificial intelligence Registro
Evolution of the inflammatory profile and redox status in COVID-19 patients: Possible therapeutic targets?
Eduardo Tamayo Gómez
Hospital Clínico Universitario de Valladolid (HCU Valladolid)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Therapies
The risk of patients with COVID19 increases with age as does the redox status and the inflammatory component. The hypothesis of this study is that in COVID19 patients there is an inflammatory profile associated with the severity of the disease that evolves depending on the patient's ability to stabilize their redox status. The objectives of this study are to perform a clinical biological and molecular characterization of Covid19 disease and to establish one of the innovative therapeutic targets and biomarkers of prognostic clinical activity. and even death that can significantly reduce the mortality trend that currently our country is suffering.
COV20/00491 Hospital Clínico Universitario de Valladolid (HCU Valladolid) No Multicentric COVID-19 disease characterization, Therapies Registro
Antiviral design for SARS based on polypharmacology
Victor Guallar
Barcelona Supercomputing Centre (BSC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
It is essential to design antivirals capable of simultaneously inhibiting various coronaviruses, thus introducing a series of molecules that can act as the first line of shock in mutations of SARS-CoV-2 and in future pandemics. For this, it is essential to locate targets with high similarity, structurally well characterized, and perform virtual screening of millions of compounds, task that is only possible with the massive use of supercomputing. With this objective, we have formed a team with extensive experience in development and massive application of software in pharmacological studies, as well as chemical synthesis and medical chemistry. Selected compounds and synthesized will be tested in different projects already underway (to which we will transfer the molecules): the Grifols-IrsiCaixa consortium and the UK's national synchrotron centre, Diamond.
COV20/00505 Barcelona Supercomputing Centre (BSC) No Unicentric Therapies
Evaluation of the Specific Immune Response to SARS-CoV-2
Ramón Gimeno Martínez
Fundación del Institut Mar d'Investigacions Médiques (FIMIM)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
Control of SARS-CoV-2 infection is based on the development of an immune response effective against the virus and in the development and maintenance of memory T-lymphocytes that can be activated if the virus reappears. The generation of memory T-lymphocytes is also necessary to ensure the effectiveness of vaccination strategies. Using cellular techniques (ELISPOT, flow cytometry) we will study the characteristics of the immune response in patients who have resolved the infection, regardless of its clinical manifestations. In addition, we will analyze the evolution of the infection and immune response in patients with chronic inflammatory diseases to study whether immunosuppressive treatments (biological or pharmacological) may have had some positive impact or negative, in the course of the infection and in the establishment of the immunological memory.
COV20/00508 Fundación del Institut Mar d'Investigacions Médiques (FIMIM) No Unicentric Therapies Registro
Prognostic variables. Consumed resources and hospital cost of patients entered by SARS-CoV-2 infection, according to their fragility
Eva María Andrés Esteban
Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
At the present time, COVID-19 has generated the greatest public health crisis, putting the health system at serious risk of collapse. Thus, in mid-March it was necessary to resort to the national state of emergency and impose a house confinement that will continue until at least mid-April, with a high probability of extension. During this time, all the services of our hospitals, and especially the emergency and intensive care services, are fully restored, exceeding 100% of the existing capacity. In this chaos, tents and pavilions are being set up to serve the increasing number of patients with mild, moderate or severe symptoms of the disease. Furthermore, the prognosis, as well as the clinical presentation, is highly variable, with no empirical evidence to corroborate these differences. In this project we want to stratify the infected population according to different stages of fragility, tempting to study the difference in evolution as well as in the use of hospital resources.
COV20/00519 Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid No Unicentric Epidemiological surveillance Registro
Retrospective cohort study to assess the effect of NSAIDs and ACE inhibitors on the prognosis of symptomatic patients with COVID-19
Raquel Cobos Campos
Asociación del Instituto de Investigación Sanitaria Bioaraba
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The aim of this project is to determine if patients with confirmed SARS-CoV-2 infection, treated with drugs that increase the expression of angiotensin-converting enzyme 2 (ACE2, ARBs and / or NSAIDs) are more at risk of poor evolution of the disease (pneumonia, ARDS and cardiac involvement), mortality or hospital admission than patients not treated with these drugs. A retrospective study of all patients with confirmed SARS-CoV-2 virus infection in Alava is proposed. All patients with confirmed infection will be followed up from the first contact with the health system until its resolution (test negative) or death, if applicable. The data will precede the electronic clinical history of each patient.
COV20/00527 Asociación del Instituto de Investigación Sanitaria Bioaraba No Unicentric Epidemiological surveillance Registro
Pre-clinical mouse models for the study of COVID-19 and trial of therapeutic strategies
Sagrario Ortega Jiménez
Fundación del Sector Público Estatal Centro Nacional de Investigaciones Oncológicas Carlos III (CNIO)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies, Vaccines
The ultimate goal of this proposal is to develop a genetically modified mouse, capable of being infected by the SARS-CoV-2 virus. We propose two models. The first consists of a knock-in model in which the murine Ace2 gene is replaced by the coding sequence of its human counterpart. We know that Ace2 knockout mice develop phenotypes that may not be rescued by expression of the human protein. Therefore, and in parallel, we propose the generation of a transgenic model, by means of a BAC that contains all the regulatory sequences of the expression of the murine Ace2 gene, and in which the coding sequence of such gene is replaced by that of the human gene (cDNA). In both models, concomitant with the expression of the human ACE2 protein, the fluorescent protein tdTomatoo will be expressed, in order to easily detect and isolate the cells susceptible to being infected by the SARS-CoVi-2 virus.
COV20/00532 Fundación del Sector Público Estatal Centro Nacional de Investigaciones Oncológicas Carlos III (CNIO) No Unicentric Therapies, Vaccines
Infection, hospitalization, ICU admission, and death from SARS-CoV-2 in a population cohort
Jesus Castilla Catalán
Fundación del Instituto de Investigación Sanitaria de Navarra (IdiSNA)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The objective of this project is to estimate the effect of sociodemographic characteristics, chronic diseases and other conditions on the risk of infection, hospitalization and severe forms of COVID-19. Methods: The population cohort covered by the Navarre Health Service (640,000 people) will be built from healthcare databases and epidemiological surveillance. Two sub-cohorts will be defined for specific analyzes: institutionalized people (n = 6,000) and health professionals (n = 12,000). The incidence rates of cases with clinical suspicion, infection confirmed by PCR, hospitalizations, ICU admissions, assisted ventilation and mortality will be calculated. Case fatality will also be calculated in confirmed and hospitalized cases. The predictor variables to be evaluated are sex, age, chronic diseases, pregnancy, obesity, hypertension, smoking, functional capacity, socioeconomic level, number of cohabitants, minors in the home and use of services. Antibody seroprevalence will be evaluated in a sample of patients from the sentinel physician network and / or donors.
COV20/00542 Fundación del Instituto de Investigación Sanitaria de Navarra (IdiSNA) No Multicentric Epidemiological surveillance Registro
Prevention of COVID19 infection by administering hydroxichlorochine in elderly institutionalised people and residential care staff. Controlled, open and randomized clinical trial (stepped-wedge) by clusters
José Miguel Morales Asensio
Fundación para la investigación de Málaga en Biomedicina y Salud (FIMABIS)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The objective is to evaluate the effectiveness of hydroxychloroquine chemoprophylaxis for healthcare personnel and elderly people in nursing homes: a) on the incidence of secondary cases of SARS-CoV-2 infection in elderly people, and b) on the incidence of SARS-CoV-2 infection in the healthcare personnel themselves. Assess the efficacy of measures to promote infection control. Controlled, randomized, open-label, stepwise cluster study in elderly people and care professionals in 4 autonomous regions using HCQ
COV20/00565 Fundación para la investigación de Málaga en Biomedicina y Salud (FIMABIS) Yes Multicentric Therapies
Deciphering ACE2-mediated SARS-CoV-2 lung infection
Carles Barceló Pascual
Fundación del Instituto de Investigación Sanitaria Illes Balears (IdISBa)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Therapies, SARS-CoV-2 characterization
Difficulty breathing due to severe pneumonia is by far, the most life-threatening emergency symptoms reported for COVID-19. This is because the SARS-CoV-2 virus accesses host cells via the enzyme ACE2, which is most abundant in the alveolar cells of the lungs. We aim to study SARS-CoV-2 receptor ACE2 to identify the regions/residues critical for an efficient cell entry. We also aim to determine how the genetic variants/polymorphisms of main receptor ACE2 found in Spanish population and different tissues impinge on SARS-CoV-2 infection capacity. This have a clear therapeutic application (e.g. development of ACE2 peptide comprising the critical region as a viral attachment inhibitor and prospective antibody generation) and can be easily transferred to the clinic as it could explain why different patients have a different susceptibility, symptoms, and outcome of COVID-19 depending on the ACE2 polymorphism. Finally in an unprecedented analysis of the COVID-19 disease in human lung epithelium, we will make use of CRISPR/Cas9 to study how ACE2-dependent SARS-CoV-2 infection affects epithelial organization, cells most susceptible to infection and we will confirm the previous findings in a totally translational/bench-to-bedside approach.
COV20/00571 Fundación del Instituto de Investigación Sanitaria Illes Balears (IdISBa) No Unicentric COVID-19 disease characterization, Therapies, SARS-CoV-2 characterization
Study of the SARS-CoV-2 viral load in the respiratory tract and blood as a factor associated with the prognosis of COVID-19 in adults
Javier Sánchez Céspedes
Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The general objective is to analyze the influence of the SARS-CoV-2 viral load on the lower respiratory tract (sputum or invasive samples if its study is indicated), as well as blood and feces as indicators of disseminated disease, as factors associated with development of pneumonia and the evolution of the disease, measured by the need for assisted ventilation and cure or death. Virological variables will be included in an analysis together with demographic variables, comorbidities, and the clinical and radiological characteristics of pneumonia. Also, the sensitivity of the SARS-CoV-2 RT-PCR in nasopharyngeal smears will be evaluated. Finally, the excretion and infectivity of the virus in feces will be determined after the patients are cured.
COV20/00580 Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (FISEVI) No Multicentric COVID-19 disease characterization Registro
Elaboration of alert COVID-19 transmission maps in urban spaces oriented to the application of anti-propagation measures on a detailed scale
Mª Jesús Perles Roselló
Universidad de Málaga (UM)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Socio-economic impact, Artificial intelligence
The project aims to analyze the spatial behavior of transmission of the Covid-19 virus in urban spaces, in order to know where the main sources of infection are located, which are more virulent and evolve at a faster rate, with what factors are related, and what are the key areas of action through anti-contagion measures to stop the spread. We understand that spatial monitoring of contagion at the urban micro-scale level is key to cutting the virus transmission chain. The spatial scope of study is made up of the urban spaces of the province of Malaga, including its capital, an urban area in which results are already being obtained.
COV20/00587 Universidad de Málaga (UM) No Unicentric Epidemiological surveillance, Socio-economic impact, Artificial intelligence
Characterization and management of Post Intensive Care Syndrome in COVID-19 patients
Gonzalo Sol Fernández
Fundació Parc Taulí
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Socio-economic impact
Implementation of a combined monitoring system (technological solutions and face-to-face visits) in patients who have overcome a critical episode by COVID-19 to characterize the Post-Intensive Care syndrome and detect early needs for specific treatment or physical and cognitive rehabilitation. The follow-up will be done in person at discharge from the ICU and 12 months after discharge from the ICU, and through the use of mobile applications and telephone calls 1 month, 3 months and 6 months after discharge from the ICU. A diagnostic tree will be developed to detect survivors of critical illness due to COVID-19 who present moderate-severe physical, cognitive and emotional disorders 3 months after discharge from the ICU. These patients will be offered an extraordinary face-to-face visit with a specialist at 6 months.
COV20/00595 Fundació Parc Taulí No Unicentric COVID-19 disease characterization, Socio-economic impact
An international randomised trial of additional treatments for COVID-19 in hospitalised patients who are all receiving the local standard of care (Solidarity)
Vicente Estrada & Antonio Portoles
Instituto de Investigación Sanitaria San Carlos (IdISSC)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
The aim of this core protocol is to compare the effects on major outcomes in hospital of the local standard of care alone versus the local standard of care plus one of four alternative anti-viral agent (Remdesivir, Chloroquine / OHchloroquine, Lopinavir + Ritonavir or Lopinavir / Ritonavir + Interferon). The primary objective is to provide reliable estimates on any effects of these anti-viral treatments on in-hospital mortality in moderate and in severe COVID and the secondary to assess any effects of these anti-viral treatments on hospital duration and receipt of ventilation or intensive care, and to identify any serious adverse reactions.
COV20/00612 Instituto de Investigación Sanitaria San Carlos (IdISSC) Yes Multicentric Therapies
Dynamic prediction of COVID-19 scenarios in the short and medium term (PREDICO)
Jorge Mira Perez
Universidad de Santiago de Compostela (USC)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Socio-economic impact, Artificial intelligence
This project aims to predict the evolution of the expansion and incidence of COVID-19, solving the main problems that the known models are facing: the disputed reliability of the available data, both due to difficulties in the detection mechanisms and to a probable abundance of asymptomatic infected people. To this end, work is being carried out on three fronts: a) on the basis of compartmental models, which provide systems of differential equations; b) with so-called Empirical Dynamic Modelling, which dispenses with equations, thus eliminating any dependence on the pre-determination of causal agents; and c) through an analysis of the Spanish social network, which will feed back into a) and b). The work in these three blocks will have continuous interconnection.
COV20/00617 Universidad de Santiago de Compostela (USC) No Unicentric Epidemiological surveillance, Socio-economic impact, Artificial intelligence
Genetic Determinants and Genomic Risk Biomarkers in Patients with SARS-COV-2 Coronavirus Infection
Angel Carracedo Alvarez (PI), Pablo Lapunzina (Co-PI)
Consorcio del Centro de Investigación Biomédica en Red MP (CIBER)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The objective of this project is to search for risk genomic biomarkers that may predispose to more serious infection, prognostic stratification and / or response genomic biomarkers in patients who have received treatment during infusion. A complete genome association study (GWAS) will be performed in a sample of 7000 Spanish patients and a complete genome sequencing study in a group of selected patients (300), collected by a national and international consortium that includes more than 15 hospitals, complemented by a high-level research group. Clinical data (signs, symptoms, and findings) and personal and epidemiological history will be collected in a common database designed ad hoc for this project. We will thus find genetic / genomic determinants of risk and poor evolution that allow a better stratification of patients and the adaptation and optimization of therapeutic protocols.
COV20/00622 Consorcio del Centro de Investigación Biomédica en Red MP (CIBER) No Multicentric COVID-19 disease characterization Registro
Design of molecular beacons for rapid and effective identification of SARS-CoV-2 RNA species in patient samples of COVID-19
Mario Fernández Fraga / Juan Ramón Tejedor Vaquero
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
Due to the health emergency caused by the outbreak of the COVID-19 pandemic, and in view of a possible scenario of rebound or chronicity of the disease, urges the development of tools that facilitate the detection and follow-up of patients susceptible to infection by the virus SARS-CoV-2. This project aims to generate an alternative, fast and sensitive test for the detection direct from human samples of virus RNA species, in order to simplify the time, costs and experimental complexity required for the current diagnosis of COVID-19. To this end, this proposal contemplates the design of a battery of molecular beacons and the use of scalable fluorimetric analysis through the use of signal amplification by a nicking enzyme (NESA) for the purpose of identification direct, effective and low cost of different species of coronavirus RNA in human samples.
COV20/00624 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Diagnostics
Prognostic variables, resources consumed and cost in primary care of patients with COVID-19
Rosa Magallón Botaya
Instituto de Investigación Sanitaria de Aragón (IISA)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Socio-economic impact
Currently, COVID-19 has generated the greatest public health crisis, putting the health care system at serious risk of collapse. Thus, in mid-March it was necessary to resort to the national state of emergency and impose a house confinement that will continue, at least until mid-April, with a high probability of extension. During this time, the health services have been completely overwhelmed. In this new situation, tents and pavilions are being set up to serve the ever-increasing number of patients with mild, moderate or severe symptoms of the disease, deriving resources from other levels of care. Furthermore, the prognosis, as well as the clinical presentation, is highly variable, and there is no empirical evidence to corroborate these differences. In this project we want to stratify the infected population that does not require hospital admission, its predisposing factors, comorbidity and fragility, as well as to analyze the use of resources in PC in this pandemic in our country.
COV20/00634 Instituto de Investigación Sanitaria de Aragón (IISA) No Unicentric Epidemiological surveillance, Socio-economic impact Registro
Treatment of patients with COVID-19 and non-severe pneumonia without hospital admission criteria: randomized clinical trial Protocol Code: COME-CLEAN EUDRACT 2020-001962-12
Carlos Guijarro Herraiz
Hospital Universitario Fundación Alcorcón
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
Objectives: to evaluate the effectiveness of 4 active treatment regimens in monotherapy (hydroxychloroquine, Prednisone, Azithromycin, or Colchicine) vs. placebo in COVID-19 patients with non-pneumonia severe without admission criteria measured as hospital admission or death in the following 2 weeks after start of treatment; assess and compare the safety of treatment guidelines at 28 days and describe changes occurred in the perception of health status at 12 weeks and analyze the impact of various clinical and sociodemographic factors in these potential changes. Design: Clinical trial randomized, multicenter, double-blind, placebo-controlled. N = 1711. Analysis by intention to treat.
COV20/00644 Hospital Universitario Fundación Alcorcón Yes Multicentric Therapies
Determinants of resistance and pathogenicity in SARS-CoV-2 infection: genomic and biochemical mechanisms
Carlos López Otín / Alejandro López Soto
Universidad de Oviedo
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
The clinical management of COVID-19 patients and the implementation of measures to prevent, alleviate and eventually eradicate the disease will require not only a complete characterization of the structural and biological features of the virus, but also a deep understanding of the molecular intricacies of the virus-host cell interaction. In this project we will carry out comparative studies aimed at identifying viral and host genomic features involved in pathogenicity and disease susceptibility. We will also study the role of cellular proteases involved in SARS-CoV-2 infection and explore their regulatory mechanisms, their endogenous inhibitors and their potential role in aging-associated disease vulnerability. These studies will be complemented with a CRISPR/Cas9-based screening designed to search for new cellular factors involved in the infection process and host response.
COV20/00652 Universidad de Oviedo No Unicentric SARS-CoV-2 characterization
COVID-19, immune risk profile (attached to 00416 project)
Jordi Bas Minguel
Fundación del Instituto de Investigación Biomédica de Bellvitge (Fundación IDIBELL)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
It is currently not known whether the minority of poorly evolving cases of COVID-19 are due to an excess or defect in the innate or adaptive immune response or to joint dysregulation. There are tools not yet applied to be able to discern between the various immunological/virological scenarios in which this infection develops. The objective of this project is to generate algorithms/indices to stratify patients by the immunological/virological risk profile applicable to the analysis of ongoing or future clinical trials with immunomodulators. Methods: 1) Capture of parameters of inflammation, coagulation, immunology and microbiology as well as general analysis in relation to the origins of the samples, demographic data and clinical evolution; 2) Measurement in 120 patients of the level of 16 cytokines and 32 lymphocyte populations for: 3) the generation of prognostic and therapeutic orientation algorithms from 2; 4) detailed identification by Nanostring® transcriptomics of the immune response pathways activated in 40 patients and thus confirm/improve the algorithm generated in 3.
COV20/00654 Fundación del Instituto de Investigación Biomédica de Bellvitge (Fundación IDIBELL) No Multicentric COVID-19 disease characterization
Identification and characterization of the protective T-immune response to SARS-CoV-2: Guiding successful vaccine design
Julia Garcia Prado
Fundació IrsiCaixa
Organization: Unicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
At present we do not know if SARS-CoV-2 infection will be able to generate immunological memory at the population level. The presence of immunological T-memory is essential for the control of a new COVID-19 outbreak. Under these premises, this project proposes: 1) To identify the regions of SARS-CoV-2 recognized by the immune T response associated with protection. 2) To determine the time of generation of these responses. 3) To characterize the functionality of T responses associated to SARS-CoV-2 protection. This information is essential to successfully design and evaluate the immunogenicity of a new prototype T vaccine in a second phase. The ultimate goal is to achieve prolonged population protection against SARS-CoV-2 through vaccination.
COV20/00660 Fundació IrsiCaixa No Unicentric SARS-CoV-2 characterization
Characterization and therapeutic management of immunological hyperactivation associated with mortality in COVID-19.
Rafael Correa Rocha
Instituto de Investigación Sanitaria Gregorio Marañón (IISGM)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The clinical deterioration of SARS-CoV-2 infection would be the result of a combination of virus-induced direct cytopathic effects and immunopathology induced by a cytokine release syndrome associated with the immune response to the virus. The experience that is being acquired in our centers indicates that in the most serious cases the clinical picture is mainly related to the activation of an exaggerated immune response and an uncontrolled inflammatory process, which leads to a multi-organ failure that ends in death. A recent study of 150 confirmed cases of COVID-19 in Wuhan has just identified elevated ferritin and IL-6 as the main predictors of mortality, confirming that the hyperinflammation caused by the response to SARS-CoV-2 would be the main cause of mortality in COVID-19. Our project aims to make an exhaustive study of the patient's immune status: i) establishing an early monitoring of cytokines to guide the targeted and personalized use of biological drugs, in order to rescue patients with a worse evolution from a probable death; ii) studying the immunological factors associated with relative risk, progression and also the development of immunity against the virus.
COV20/00668 Instituto de Investigación Sanitaria Gregorio Marañón (IISGM) No Unicentric COVID-19 disease characterization
Registry of SARS-CoV-2 infection in patients with hemoglobinopathies and / or splenectomized: epidemiological surveillance and study of morbidity and mortality in risk groups.
Elena Cela de Julián
Instituto de Investigación Sanitaria Gregorio Marañón (IISGM)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The registry of SARS-CoV-2 infection in pediatric patients with hemoglobinopathies with clinical severity, such as sickle cell disease (SCD) or thalassemia major (TM), among others and / or splenectomized patients, aims to collect epidemiological information relevant to the surveillance of this risk group; The aim is to study morbidity and mortality in this population in addition to quantifying the resources used by this population during the current epidemic situation (hospitalization rate, treatments used, admission rate in intensive care units, among other markers). from an observational, descriptive, multicenter and ambispective study. This study wants to study the socioeconomic impact and epidemiology of COVID-19 disease in this population group.
COV20/00675 Instituto de Investigación Sanitaria Gregorio Marañón (IISGM) No Multicentric Epidemiological surveillance Registro
Creation of the COVID19 patient cohort and samples associated with the Biobank of the Instituto de Investigación Sanitaria Galicia Sur (IISGS)
Eva Poveda López
Fundación Biomédica Galicia Sur
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Epidemiological surveillance
The creation of the COVID19 patient cohort and samples associated with the IISGS Biobank in the Vigo health area provides the basis for the study of COVID-19 disease in a standardized and quality way. It will allow the execution of clinical and experimental studies to increase our knowledge and optimize the prevention, diagnosis, clinical follow-up and treatment of patients infected with SARS-COV-2 locally and globally, favoring consortia and study groups with other national centers and for the development of joint research projects. For this, a Coordination Unit of the COVID19-IISGS Cohort and a Scientific-Technical Committee have been created for the evaluation of research projects that require the use of data and samples from the cohort once they have the approval of the Relevant Ethics Committees.
COV20/00698 Fundación Biomédica Galicia Sur No Unicentric COVID-19 disease characterization, Epidemiological surveillance Registro
Use of ozone for the reuse of personal protective equipment (PPE). O3CoVid19PPE study
Bernardino Clavo Varas
Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies, Socio-economic impact
The fight currently taking place in Spain against CoVidl9 has many fronts. One of the most important at a strategic level is the shortage of personal protective equipment (PPE), which has resulted in: 1) a high percentage of infected healthcare professionals, 2) reduction in the number of operating professionals, a high percentage of infected health professionals, 2) reduction in the number of operating professionals, 3) that professionals can spread the infection. Ozone has been used for decades in the treatment and disinfection of water (waste and for public use) and air. At low concentrations it destroys most viruses in a few minutes. If this effect on CoVid19 is confirmed, ozone could be used to: 1) inactivate the virus in PPE and facilitate its rapid reuse and availability for professionals, 2) decrease the number of PPE withdrawal procedures as a risk factor. The basic idea of ​​this project was published, as a comment, in March-2020 in the JAMA magazine.
COV20/00702 Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC) No Unicentric Therapies, Socio-economic impact
MIND/COVID-19: Mental health Impact and NeeDs associated with COVID-19: a comprehensive national evaluation in Spain.
Jordi Alonso Caballero
Fundación del Instituto Mar de Investigaciones Médicas (FIMIM)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
A prospective cohort study of three groups: (1) COVID-19 cases or close contacts recently isolated or quarantined; (2) healthcare workers; and (3) the general population, including both adults and children/adolescents. Recruitment through epidemiologic surveillance services, hospitals, primary care centers in 6 Spanish Autonomous Communities (groups 1 & 2), a panel survey (group 3 - adults), and snowball sampling through social media (group 3 - children/adolescents). Web-based surveys at baseline and 6-month follow-up assess: current living and employment status; COVID-19 infection status; mental health (post-traumatic stress, panic, depression, anxiety, alcohol use, suicidality; services use); psychological functioning; health and quality of life. Specific modules focus on impact of isolation or quarantine (group 1) and care for COVID-19 patients (group 2). Children/adolescents receive adapted modules. Smartphone-based daily brief surveys among groups 1 & 2 will provide additional assessment of main outcomes in the two weeks following baseline assessment.
COV20/00711 Fundación del Instituto Mar de Investigaciones Médicas (FIMIM) No Multicentric Epidemiological surveillance Registro
Study of the dynamics of the SARS-CoV-2 epidemic with physical-mathematical epidemiological models. Monitoring, control strategies, simulations and surveys
Antonio Guirao Piñera
Universidad de Murcia
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Research initiated on the dynamics of growth of the SARS-CoV-2 epidemic will be continued using physical-mathematical epidemiological models. The study will be conducted on official data on the number of patients. The following will be investigated: phases of the epidemic (exponential growth, peak and decline); severity according to peak height and width; growth rate and reproductive number; effect of uncertainty on the number of infected persons. The scientific basis for the design of the most suitable containment strategies according to parameter optimization (not only containment) will be proposed. Simulations will be carried out in different scenarios of the incidence and affected curves, which will help to anticipate control measures, and to understand the risk of importing cases and outbreaks.
COV20/00736 Universidad de Murcia No Unicentric Epidemiological surveillance
Design and development of peptide inhibitors of SARS CoV2 virus entry for human use
Bruno Sainz Anding
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
Herein we are proposing the use of a low throughput peptide-screening assay to identify peptides that can inhibit SARS-CoV2 virus entry. The rationale is logical, the technology developed to identify these peptides, the feasibility of using peptides inhibitors of viral entry has been tested and proven and the translation of such findings to the clinic (e.g. clinical trials) is practical. Hence, our group is well positioned to tackle the immediate and growing need to develop novel compounds that can treat patients infected with SARS-CoV2. As principal investigator, I have a proven track record in Virology, with a particular emphasis on viral entry and the development and / or identification of compounds that inhibit viral entry. Thus, the proposal outlined below is well within my and my laboratories expertise and capabilities.
COV20/00749 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Therapies
Radiographic screening, chest inspection in patients with COVID19
Francisco Javier Albiol Colomer
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Artificial intelligence
One of the symptomatic aspects of COVID19 is the effect of pneumonia. Our group is an expert in image analysis and its treatment for combined use with radiologists. With the resources we have available, we want to help develop a radiological screening system based on artificial intelligence to help identify the severity of the pathology. During the project, the solution's exploitation capacity will be looked for, looking for leading companies in the sector as engines for the acquisition of images.
COV20/00750 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Artificial intelligence
Short and medium term therapies for the treatment of COVID-19: senolytics and vaccine development
Cayetano Von Kobbe
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies, Vaccines
According to the WHO, hypertension, cardiovascular and chronic respiratory diseases, diabetes, immunosuppression, cancer, along with old age, belong to the specific risk group of people affected by the current COVID-19 pandemic. As we age, our body accumulates senescent cells, which produce harmful effects on the body, and are known to play a causal role in the onset of the diseases listed above. This fact, together with known data, place senescent cells as targets to eliminate or alleviate the symptoms of the infection. The main objective of this project is the specific elimination of senescent cells through the use of senolytics, in order to improve the clinical picture of those affected. The fact that some senolytics are already in the clinical phase, means that their use in patients would be faster. The development of vaccines based on cellular response, is also raised here.
COV20/00755 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Therapies, Vaccines
Structural and Dynamic Characteristics of Intrinsically Disordered Proteins of the SARS-CoV-2 Virus
Douglas Vinson Laurents, Miguel Mompeán García
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Multicentric
Clinical trial: No
Topic call: SARS-CoV-2 characterization
A significant proportion of the SARS-CoV-2 proteome lacks homology with known proteins and appears to have no defined structure. Proteins intrinsically Disordered (IDP) are essential for viral infections, as they hijack human regulatory networks. IDPs are refractory to structural analysis using X-ray crystallography or cryo-electron microscopy. The objective of this project is to characterize the partial structure and dynamics of three disordered proteins and three peptides of the SARS-CoV-2 proteome, for example, the segment that covers residues 962-1021: FGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPWQ. We will use NMR spectroscopy and molecular dynamics, which are the only methods that provide information at the atomic level on IDPs.
COV20/00764 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Multicentric SARS-CoV-2 characterization
Mechanistic model based on artificial intelligence for the reuse of drugs against SARS-CoV-2 infection
Joaquín Dopazo Blázquez
Fundación Pública Andaluza Progreso y Salud
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
The rapid expansion of SARS-CoV-2, a new virus, has caught health systems without adequate therapy. Although the development of a new drug is not feasible in the short term, the solution of reusing drugs with other indications would bring closer the availability of new therapies. Computational approaches have been shown to be faster and cheaper than experimental ones. Among these, those based on mechanistic models, which allow inferring cause-effect relationships, have shown greater effectiveness than traditional solutions such as virtual screening or others. We propose the use of a mechanistic model based on artificial intelligence that has already demonstrated its effectiveness in rare diseases for the reuse of drugs for Covid-19.
COV20/00788 Fundación Pública Andaluza Progreso y Salud No Unicentric Therapies
Clinical utility of analysis of IL-6 signaling as an indicator of COVID-19 disease activity. Therapeutic opportunity with IL-6 trans-signaling blockers
Matilde Bustos de Abajo
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
1) Análisis de la respuesta inflamatoria mediante perfil de citoquinas en suero relacionadas con señalización de IL-6 para estratificar pacientes, valorar actividad de la enfermedad COVI-19 y seleccionar pacientes donde atenuar la respuesta inflamatoria mediante el bloqueo de IL-6. 2) Análisis de SNPs de los genes que participan en la señalización de IL-6 que puedan explicar reacciones exacerbadas (datos bioinformaticos y datos a obtener con nuestras muestras). 3) Demostrar la importancia de un bloqueo selectivo de IL-6. es decir bloquear sólo el trans-signalling de IL-6 en los pacientes donde exista una respuesta inflamatoria grave con altos niveles de receptor soluble de IL-6 (sIL-6R) y bajos sgp130 (buffer natural del trans-signaling), no se afecta la clásica de IL-6. Esto contrasta con el uso de Tociluzimab, donde se inhiben no se afecta la clásica de IL-6. Esto contrasta con el uso de Tociluzimab, donde se inhiben todas las respuestas de IL-6 con afectación de la señalización clásica regeneradora y de defensa de IL-6 en los procesos de inflamación.
COV20/00792 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Multicentric COVID-19 disease characterization
Clinical and immunovirological aspects of SARS-CoV2 infection in a cohort of pregnant women and newborns.
Maria Luisa Navarro Gómez
Instituto de Investigación Sanitaria Gregorio Marañón (IISGM)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
National prospective multicenter study conducted in RECLIP healthcare centers. At least 150 mother-newborn couples with confirmed SARS-CoV2 infection will be tested during pregnancy. Epidemiological, clinical aspects, infection treatments, evolution will be collected. Microbiological studies of SARS-Cov-2 will be carried out in 50 couples in respiratory samples, blood, placenta, urine and feces of the newborn, breast milk, and immunological samples at the time of diagnosis of the pregnant woman and at birth in the newborn. , and prospectively up to 6 months of infant life, aimed at knowing in depth the transmission of the infection as well as the immune response that occurs in these populations against SARS-CoV-2.
COV20/00808 Instituto de Investigación Sanitaria Gregorio Marañón (IISGM) No Multicentric COVID-19 disease characterization Registro
Study of the protection of BCG and MTBVAC against SARS-COV-2 in primates
Carlos Martín Montañés
Universidad de Zaragoza
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
Study of the prophylactic activity of trained innate immunity induced by MTBVAC live attenuated vaccine compared to BCG against SARS-CoV2 in the rhesus macaque (Macaca mulatta) model at the Biomedical Primate Research Centre (BPRC) in the Netherlands. The present research is part of the studies that the BPRC is going to start on the protective activity by the increase of trained immunity induced by BCG against SARS-CoV2 by studying the inoculation of BCG vaccine by different routes administration (intradermal, pulmonary and intravenous).
COV20/00820 Universidad de Zaragoza No Unicentric Vaccines
Rapid serological testing for combined detection of IgG and IgM against SARS-CoV-2
Ciara O`Sulivan
Universitat Rovira i Virgili
Organization: Multicentric
Clinical trial: No
Topic call: Diagnostics
The project aims at the development of a rapid and easy-to-use serological test for the screening of COVID-19 and the differentiation between current and past infections. The addition of fingerpick blood sample and a final immersion of dipstick/addition of substrate is the only required end-user intervention. It is based on the detection of the IgM and IgG antibodies produced by the infected person`s immune system to fight the infection. The assay design will differ from the common format used by numerous manufacturers to eliminate the possibility of false negative results. Gold and carbon nanoparticle labels will be used for visual readout and the specific colour combination on the strips will be related to the presence of specific antibody type. A recombinant COVID-19 antigen will be prepared for the final preparation of prototype tests to be validated using patient blood samples. The assay time will be less than 15 minutes and the production cost will be 1€. The methodology will be disseminated internationally and can be easily implemented globally.
COV20/00823 Universitat Rovira i Virgili No Multicentric Diagnostics
Incidence and characterization of low / high risk of complication profiles in people >60 years with COVID-19.
Ángel Vila Córcoles
IDIAP Jordi Gol
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Population-based cohort study, with 4-month retrospective-prospective follow-up (03/03 / 2020-30 / 06/2020), which will include 48,000 people> 60 years from Tarragona (1,500 of them institutionalized). Objectives: (i) to know the real incidence of COVID-19 infection, discriminating according to "confirmed" (PCR +) and / or "suspicious" cases (COVID19-like without PCR confirmation); (ii) identify the frequency of presentation (initial and during the evolution) of symptoms and signs of the disease in both types of patients (confirmed / suspected); (iii) characterize the clinical presentation profile (symptoms and signs) of COVID-19 infection in the population and explore models for predicting low / high risk profiles of complication (sudden worsening, need for hospitalization / ICU, death) based on possible predictive covariates (sex, age, symptoms / signs, comorbidity and previous medication).
COV20/00852 IDIAP Jordi Gol No Unicentric Epidemiological surveillance Registro
Application of AI to the immediate prediction of time series to optimize resource management in epidemics
José Luis Aznarte Mellado
Universidad Nacional de Educación a Distancia (UNED)
Organization: Multicentric
Clinical trial: No
Topic call: Socio-economic impact, Artificial intelligence
Given the uncertainty generated by the health crisis, and based on the large amount of data generated every day on the COVID19 disease, we propose to apply the most modern and reliable techniques for the analysis and prediction of space-time series using / deep-learning / and others. paradigms of artificial intelligence. The objective is to immediately develop predictive systems for infections, admissions, patients in the ICU and deaths by province and autonomous community, along with other magnitudes (logistical, economic, ...) that allow for more effective orientation of the action of the Ministry of Health in this and other crises. In addition, a retrospective analysis is proposed that enables the start date of each focus of the epidemic to be determined a posteriori, as well as visualization tools and dashboards that allow useful knowledge to be extracted and decision-making to be facilitated from the data.
COV20/00856 Universidad Nacional de Educación a Distancia (UNED) No Multicentric Socio-economic impact, Artificial intelligence
Dual Vaccinia MVA virus for immunization against SARS-CoV-2
Rafael Blasco Lozano
Instituto Nacional de Investigación y Tecnología Agraria y Alimentaria, O.A., M.P.
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
For greater effectiveness and potency, an ideal vaccine should induce both a humoral and a cellular memory response. We have a methodology developed to obtain recombinant vaccinia MVA viruses that simultaneously express two antigens from two separate loci of the genome, without inactivating any virus gene that can attenuate the response. In the case of COVID-19, it seems likely that protein S induces good neutralizing antibodies but a poor cellular response, so we propose to generate vaccine candidates that enhance the T cell response by expressing, in addition to SARS glycoprotein S -CoV-2, the ns1 / 2 or N proteins. These vaccine candidates must be able to induce humoral immunity in addition to cellular immunity against conserved epitopes on intracellular proteins. Once the recombinant viruses have been generated, their immunogenic capacity will be evaluated in mouse models.
COV20/00901 Instituto Nacional de Investigación y Tecnología Agraria y Alimentaria, O.A., M.P. No Unicentric Vaccines
Seroprevalence against SARS-CoV-2 in pregnant women and newborns.
Javier Llorca Díaz / María Jesús Cabero Pérez
Instituto de Investigación Sanitaria Marqués de Valdecilla (IDIVAL)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Cohort study including 1,000 pregnant women and their 1,000 newborns in the Cantabria community, which will be followed for one year. Determinations of IgG and IgM antiSARS-CoV-2 will be carried out in the mother in the first pregnancy consultation, on the day of delivery and at 6 and 12 months after delivery; in the newborn on the day of birth and at 6 and 12 months. Sociodemographic information and the process of care for pregnancy and childbirth will be collected. At follow-up, somatometry and psychomotor development of the newborn will be evaluated.
COV20/00923 Instituto de Investigación Sanitaria Marqués de Valdecilla (IDIVAL) No Unicentric Epidemiological surveillance Registro
Regulation of macrophage extravasation by a2 adrenergic agonists in the STC associated with COVID-19
José Federico Díaz González
Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
Patients with severe COVID-19 develop a cytokine storm syndrome (CTS) that seriously worsens their prognosis. STC is characterized by excessive accumulation of activated macrophages that cause massive release of proinflammatory cytokines. Macrophage depletion in STC development has been reported to decrease lethality in several animal models. Data from our laboratory demonstrate that agonists of the α2-adrenergic receptors prevent the accumulation of neutrophils in the inflammatory focus and preliminary results have prevented the accumulation of neutrophils in the inflammatory focus and preliminary results have shown a similar anti-inflammatory effect in circulating monocytes. . The main objective of this project is to generate the mechanistic rationality that allows to support a2 adrenergic agonists as modulators of monocyte migration to the inflammatory focus, in order to prevent / treat COVID-19 patients who develop an STC.
COV20/00932 Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC) No Unicentric Therapies
Medium and long-term forecast of the spread of COVID-19
David Expósito Singh
Universidad Carlos III
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
This project seeks to evaluate, by simulating: (1) analyzing the effect of the spread of new epidemics on a European scale as well as the effectiveness of policies to restrict the movement of individuals; (2) the impact of climatic conditions (both summer and winter) on the spread of the epidemic; (3) the effect of a potential summer and winter) on the spread of the epidemic; (3) the effect of a potential selective vaccination of the population taking into account different levels of vaccine efficacy as well as potential mutations in the virus that decrease the immunity of the group that has already been vaccinated or has suffered from the disease; (4) the efficiency of different measures of social distancing (closing of schools, closing of work or remote work for a percentage of the working class, social isolation, etc.) on the following stages of infection taking into account different possible levels of immunization collective.
COV20/00935 Universidad Carlos III No Multicentric Epidemiological surveillance
Immunological and virological factors in COVID-19 and their correlation with the evolution to severe forms of the disease.
Mercedes García Gasalla
Instituto de Investigación Sanitaria Illes Balears (IdISBa)
Organization: Multicentric
Clinical trial: No
Topic call: Diagnostics
Prospective study to be carried out at the Son Espases and Son LLátzer Hospitals in Palma de Mallorca, the objective of which is to identify virological and immunological factors, as well as clinical, radiological and analytical factors, related to severe forms of COVID-19. During the months of April and May 20120, 150 patients diagnosed with mild, severe and moderate COVID-19 (50 patients in each group) will be recruited and peripheral blood measurements will be performed at baseline levels and at 2 weeks of IL1, IL6, IL8, IL10, TNFa and IL2R, from lymphocyte subpopulations and complement study, as well as semiquantitative viral load study in oropharyngeal and peripheral blood and Ac production against SARS-VOC-2. The relationship of these parameters with the epidemiological, clinical and radiological variables of mild, severe and moderate COVID-2 will be analyzed.
COV20/00943 Instituto de Investigación Sanitaria Illes Balears (IdISBa) No Multicentric Diagnostics Registro
Observational multicenter registry of patients with SARS-COV-2 infection in Spanish UCIPs (SECIP-COVID)
Rafael González Cortes
Instituto de Investigación Sanitaria Gregorio Marañón (IISGM)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
Prospective multicenter observational study to characterize the infection in pediatric critically ill patients with SARS-COVID-19. It is an on-line registration through an electronic form in which pediatric ICUs from all over Spain will participate. The registry is promoted and sponsored by the Spanish Society of Care throughout Spain. The registry is promoted and sponsored by the Spanish Society of Pediatric Intensive Care. Demographic, clinical upon admission, epidemiological, diagnostic, therapeutic, microbiological and prognostic variables will be recorded.
COV20/00944 Instituto de Investigación Sanitaria Gregorio Marañón (IISGM) No Multicentric COVID-19 disease characterization Registro
EMCOVID-19: Multiple Sclerosis and COVID-19.
Luís Brieva Ruiz
Instituto Inv. Biomédica de Lleida. Fundación Dr. Pifarre (IRBLLEIDA)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Therapies, SARS-CoV-2 characterization
MS is an autoimmune disease and its interaction with COVID-19 infection has not yet been studied. This is important for several reasons. 1) COVID-19 infection could modify the evolution of MS 2) MS could alter the response to COVID-19. The evolution of the infection according to the immunomodulatory treatment (TME) received and whether it alters the evolution of the MS has not been studied either. In this we intend to study a) how the SARS-VOC-2 contagion affects the clinical and immunological status of patients with MS based on the characteristics of their MS and the TME they take, b) how MS and treatment with TME influence in the appearance and development of SARS-COV-2 infection and c) if there are beneficial effects of some TME in the evolution of SARS-COV-2 infection or if some drugs used in the treatment of infection could be beneficial for MS treatment.
COV20/00948 Instituto Inv. Biomédica de Lleida. Fundación Dr. Pifarre (IRBLLEIDA) No Unicentric COVID-19 disease characterization, Therapies, SARS-CoV-2 characterization Registro
Naïve T lymphocyte levels as a predictor of the efficacy of the immune response against SARS-CoV-2 and its potential vaccines
Rebeca Alonso Arias
Fundación para la Investigación e Innovación Biosanitaria en el Principado de Asturias (FINBA)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
The effective immune response capacity against a new pathogen will depend primarily on the specific recognition capacity of the naTve T lymphocytes. The reduction of these cells as a consequence of physiological aging or secondary to pathology could be responsible for the inadequate control of infection against SARS-COV-2. In patients with a certain genetic or pathophysiological component, an exaggerated and uncontrolled inflammatory response may occur, perhaps as a compensatory mechanism, which, together with other risk factors, leads to a fatal outcome. Defining the lymphocyte profile that characterizes patients with different degrees of involvement by SARS-CoV-2 will allow predicting those at higher risk of different degrees of involvement by SARS-CoV-2 will allow prediction of those at increased risk of complications or who may not benefit of vaccination once it is available.
COV20/00968 Fundación para la Investigación e Innovación Biosanitaria en el Principado de Asturias (FINBA) No Unicentric Therapies Registro
Impact of the COVID-19 pandemic on the mental health of workers in health devices. International multicenter study: The COVID-19 HEROES study
María Fe Bravo Ortiz
Fundación de Investigación Biomédica del Hospital La Paz (IdiPAZ)
Organization: Multicentric
Clinical trial: No
Topic call: Socio-economic impact
Although outbreaks of previous infectious diseases such as SARS have generated mental health problems in affected communities, the health emergency caused by SARS-CoV-2 is reaching an unprecedented impact, bringing health systems like the Spanish one to collapse. The data from China emphasize the importance and urgency of examining the psychosocial impact of COVID-19. This urgency is even greater in the case of people with a higher level of risk, among which are workers of sanitary devices. Given the magnitude of this public health problem and the exposure to the pandemic and its derivatives suffered by healthcare workers, this prospective, multi-center, 12-month follow-up cohort study identifies stressors and protective factors, in order to inform health policies immediately.
COV20/00988 Fundación de Investigación Biomédica del Hospital La Paz (IdiPAZ) No Multicentric Socio-economic impact Registro
Disruption of viral transport processes mediated by microtubules
José Fernando Díaz Pereira
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Unicentric
Clinical trial: No
Topic call: Therapies
SARS-CoV-2 depends on microtubules for its internalization and release process, therefore microtubules can be an effective target to stop its replication. since they are involved in important cellular processes essential for growth and proliferation, essential for viral replication. Tools are available to visualize the movement of microtubular transporters bound to viral model peptides and thus assess their response to minuscule concentrations of drugs as well as the world's largest library of drugs directed against tubulin. A screening of the library will be performed in the evaluation system developed looking for drugs that inhibit this transport and viral replication at tolerable doses.
COV20/01007 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Unicentric Therapies
Determination of phenotypes predictive of complications in COVID-19 and evaluation of the efficacy of immunosuppressive treatments
Jesús Rodríguez Baño
Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (Fisevi)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Therapies
The objective of the project is (1) to identify phenotypes predictive of the need for mechanical ventilation in the initial evaluation of patients and their evolution in the first days of admission, and (2) to evaluate the efficacy and safety of immunosuppressive treatments used in patients without mechanical ventilation with elevated markers of macrophage activation syndrome. They will be carried out through retrospective multicentre cohort studies, with advanced statistical analyzes for observational studies.
COV20/01031 Fundación Pública Andaluza para la Gestión de la Investigación en Salud de Sevilla (Fisevi) No Unicentric COVID-19 disease characterization, Therapies Registro
SARS-COV-2 diagnosis by phi29 polymerase amplification
Felipe Cortés Ledesma / Luis Blanco Dávila
Centro Nacional de Investigaciones Oncológicas Carlos III (CNIO)
Organization: Unicentric
Clinical trial: No
Topic call: Diagnostics
The project aims the validation of a reliable method for diagnosis of SARS-COV-2 infection. This novel method will allow the improved detection of the viral RNA molecule by means of a virus-specific linear probe that becomes circularized only in the presence of the viral RNA. Once the probe becomes circular, an engineered form of phi29 DNA polymerase (CSIC patent licensed to 4basebio) will start copying the circular template by generating an unlimited synthesis reaction defined as "rolling-circle replication" (RCR), which depends on the unique and robust strand-displacement synthesis capacity of this phi29 DNA polymerase variant. This peculiar mode of synthesis, a hallmark of the isothermal DNA amplification of full genomes used worldwide, could be easily detected as a readout of the presence of SARS-COV-2 genomic RNA.
COV20/01036 Centro Nacional de Investigaciones Oncológicas Carlos III (CNIO) No Unicentric Diagnostics
Safety of Breastfeeding (BF) in SARS-COV-2 (COVID-19) Confirmed Infection
Adelina Pellicer Martínez
Fundación de Investigación Biomédica del Hospital La Paz (IdiPAZ)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance
Currently, there are no formal studies on the efficacy of BF in the transfer of protective factors against SARS_COV-2, and its safety, understood as the exclusion of it as a source of virus spread and cause of disease in the infant. The LM is fundamental for the correct development of the most vulnerable neonatal populations. This cohort study will evaluate if there is transmission of the virus through LM (using highly sensitive technology) and if it depends on the viral load. In addition, it will investigate the transfer of immune / inflammatory factors and microbiological markers potentially associated with Covid-19 severity.
COV20/01046 Fundación de Investigación Biomédica del Hospital La Paz (IdiPAZ) No Multicentric Epidemiological surveillance Registro
Study of contamination of surfaces and personal protective equipment by patients with severe respiratory infection by coronavirus 2 (SARS-CoV-2) of symptomatic patients treated
Oriol Roca
Fundación del Instituto de Investigación Sanitaria Vall d'Hebron (VHIR)
Organization: Multicentric
Clinical trial: No
Topic call: Therapies
The use of high-flow nasal cannulas (CNAFs) in SARS-CoV-2 disease (the causative agent of COVID-19) may be limited by the risk of aerosol generation that has been associated with increased risk of transmission of airborne pathogens. Our objective will be to determine the degree of contamination of the surfaces and personal protective equipment of patients with SARS-CoV-2 disease treated with CNAF or mechanical ventilation (MV) that require admission to the Intensive Medicine Service. Smears will be taken from surfaces and from personal protective equipment (PPE) and RT-qPCR will be performed to detect the presence of SARS-CoV-2. Furthermore, RT-qPCR positive samples were cultured in Vero E6 cells to determine the presence of infectious virus.
COV20/01054 Fundación del Instituto de Investigación Sanitaria Vall d'Hebron (VHIR) No Multicentric Therapies
Simulation and evaluation of the transmission dynamics of the SARS-CoV-2 virus in Spain
Óscar Gálvez González
Universidad Nacional de Educación a Distancia (UNED)
Organization: Multicentric
Clinical trial: No
Topic call: Epidemiological surveillance, Artificial intelligence
This project aims to build an own and realistic model of society to study the transmission dynamics of the SARS-CoV-2 virus in Spain. The model is based on the random movement to transmission dynamics of the SARS-CoV-2 virus in Spain. The model is based on the random movement through the Metropolis Monte Carlo method of a large number of individuals (from 100,000 to 1,000,000) who interact in certain interconnected scenarios whose parameterization tries to describe the different social collectivities of people (work , school, family, etc.). An expanded SIR model will be used, for the characteristics of the individuals and by means of an adequate calibration with the available data, the values ​​of the effective number of reproduction and generation time of the virus in each social layer will be obtained, assessing the validity of possible scenarios and measures to control the epidemic.
COV20/01081 Universidad Nacional de Educación a Distancia (UNED) No Multicentric Epidemiological surveillance, Artificial intelligence
CoviNanoVax: Design of a mRNA vaccine based on polymeric nanoparticles targeting dendritic cells.
Salvador Borrós/ Cristina Fornaguera
Universidad Ramón Llull (URL)
Organization: Unicentric
Clinical trial: No
Topic call: Vaccines
CoviNanoVax arose from our previous experience in the development of polymeric nanosystems loaded with genetic material selectively targeting dendritic cells (DCs). These nanosystems will be used here as vaccines for the prevention of CoVid19. A coding mRNA will be encapsulated for the SARS-CoV-2 nucleocapsid antigenic proteins, so that once the nanoparticles are injected into a healthy patient, they will selectively target and transfect DCs. As an mRNA encoding only the antigenic proteins, and taking into account that retrotranscriptase will not be present, the safety of the vaccine will be very high and, at the same time, since the mRNA is a highly antigenic macromolecule, it will develop a specific immune response to immunize healthy but susceptible people and protect them against future SARS-CoV-2 infections.
COV20/01100 Universidad Ramón Llull (URL) No Unicentric Vaccines
Clinical trial for the Prevention of Coronavirus Infection in Healthcare professionals (EPICOS)
Julia del Amo Valer
Fundación Estatal, Salud, Infancia y Bienestar Social, F.S.P. (fcsai)
Organization: Multicentric
Clinical trial: Yes
Topic call: Therapies
Randomized clinical trial to evaluate the efficacy of Tenofovir (TDF) (245 mg) / Emtricitabine (FTC) (200 mg) single tablet daily dose, Hydroxychloroquine (HC) single tablet daily dose (200 mg), and dose daily TDF (245 mg) / FTC (200 mg) plus HC (200 mg) or placebo, for 12 weeks in: (1) decreased incidence of symptomatic disease and (2) decreased clinical severity of infection by coronavirus (COVID-19) in hospital health personnel aged 18 to 65 years exposed to coronavirus infection (COVID-19) in Spain.
COV20/01112 Fundación Estatal, Salud, Infancia y Bienestar Social, F.S.P. (fcsai) Yes Multicentric Therapies
Registry of patients with inflammatory and autoimmune diseases with SARS-CoV2 infection.
Ricardo Blanco Alonso / Miguel Ángel González-Gay
Instituto de Investigación Sanitaria Marqués de Valdecilla (IDIVAL)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The project tries to generate a registry of all patients diagnosed with SARS-CoV2 infection and previously diagnosed rheumatic disease. For this, data from the ECHR of SARS-CoV2 + patients and rheumatological diseases will be collected in relation to their underlying disease, their previous treatment, the treatment that was being used when the symptoms of the infection began, the course of the disease until its resolution, including the appearance of complications, the therapies used as treatment and the presence of risk factors. The objective is to subsequently analyze the data obtained in order to determine what is the influence of rheumatic diseases in the course of infection and whether the therapies administered can be beneficial or harmful in terms of prophylaxis and / or less or greater severity of the infection.
COV20/01138 Instituto de Investigación Sanitaria Marqués de Valdecilla (IDIVAL) No Unicentric Epidemiological surveillance Registro
Changes in lung function tests in patients with CoVid-9 pneumonia
Jaime Signes-Costa Miñana
Fundación del Hospital Clínico Universitario de Valencia (INCLIVA)
Organization: Unicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
The project consists of a prospective, observational, multicenter study that will evaluate changes in lung function (forced spirometry, measurement of static lung volumes using plethysmography and pulmonary carbon monoxide diffusion test) that patients admitted with pneumonia will present. by CoVid19 according to the level of severity at 4 and 26 weeks after discharge from hospital. Restrictive pulmonary abnormalities will be confirmed by imaging tests (high resolution chest CT). The presence of immune response phenomena that lead to pulmonary fibrosis will be related to demographic, clinical variables and a series of biological markers, some of them already described as co-participants in the pathogenesis of pulmonary interstitial diseases, specifically the idiopathic pulmonary fibrosis.
COV20/01209 Fundación del Hospital Clínico Universitario de Valencia (INCLIVA) No Unicentric COVID-19 disease characterization Registro
Mathematical modeling and prediction of incidence of COVID-19 outbreaks in Europe
Manuel de la Sen
Universidad del País Vasco
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
We will develop a series of mathematical models that describe the current epidemic of coronavirus COVID19, with different levels of sophistication: SIR, SEIR, SSEEIIR, with various delays and infectious structures adapted to the updated medical literature, according to medical studies that specify the parameters of the local situation. . The adjustment method of the various parameters will be performed using linear regression (normal equation) and machine learning (gradient descent). We will take into account the impact of the social distancing imposed in various states, as well as other control strategies, in order to measure its effectiveness and determine the best measures to prevent future COVID outbreaks in the future.
COV20/01213 Universidad del País Vasco No Unicentric Epidemiological surveillance
Structural analysis of SARS-CoV-2 membrane proteins for the design of new inhibitors of viral assembly
Marcial Vilar
Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization, Therapies
Highly pathogenic human respiratory coronaviruses of the SARS family (SARS-CoV, MERS and SARS-CoV-2) cause acute lethal disease characterized by responses exuberant inflammatory and lung damage. The fundamental step of virus replication and dissemination is its complete assembly in the intermediate region between the ER and the Golgi (ERGIC), which depends on protein-protein interactions between structural viral proteins, mainly intramembrane interactions. However, the complexity of this type of interactions and the lack of structural information has to date made it impossible to understand how CoV viruses are assembled and to design therapeutic tools that prevent this. With the achievement of this project we will provide structural information of these interactions to the scientific and pharmaceutical community as a first step to achieve their inhibition and the subsequent viral assembly.
COV20/01265 Agencia Estatal Consejo Superior de Investigaciones Científicas (CSIC) No Multicentric COVID-19 disease characterization, Therapies
Dynamic calculation of the SARS-CoV-2 capsid for destruction by resonance (VirionBreak)
Fermín Luis Navarrina Martínez
Universidad de la Coruña (UC)
Organization: Multicentric
Clinical trial: No
Topic call: Therapies
The objective of the project is to carry out a dynamic structural analysis of the SARS-CoV-2 virus capsid in order to obtain its own frequencies and modes of vibration, and determine the characteristics of a radio frequency emission that may cause its collapse. These results will define the design parameters of an emitting device (probably microwave in the SHF and EHF bands of the electromagnetic spectrum) that allows destroying the virus capsid totally or partially by induced resonance. In your case, the construction of a prototype and its subsequent manufacture could be carried out in a short time and with low costs. The device could be used for prophylactic purposes immediately for disinfecting inert material and contaminated biological waste. In case the vibration frequencies and the energy necessary to cause the destruction of the capsid are innocuous, the same principle could also be applied for therapeutic treatment.
COV20/01275 Universidad de la Coruña (UC) No Multicentric Therapies
Th1 / Th2 / Th17 / Treg response and TLRs / KIR receptors in clinical evolution of COVID19
Alejandro Vallejo Tiller
Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS)
Organization: Unicentric
Clinical trial: No
Topic call: Epidemiological surveillance
The immune response is crucial in patients from 5-7 days of symptom evolution. At that time, certain patients trigger an exaggerated immune response that exacerbates their clinical condition (cytokine storm), while others progress without known cause. Being able to analyze the Th1, Th2, Treg and Th17 response in these patients on admission could have predictive value for subsequent disease severity. An exacerbated activation of the Th1 response and low Th2 could produce this described cytokine storm. The Treg and Th17 response could also modulate that response. In parallel, the initial control of SARS-CoV-2 infection is also limited by the expression of Toll receptors as receptors (TLR) expressed on monocytes and dendritic (TLR-7 and TLR-8). Likewise, the KIR receptors of NK cells are important for the elimination of viral infections.
COV20/01304 Fundación de Investigación Biomédica del Hospital Ramón y Cajal (IRYCIS) No Unicentric Epidemiological surveillance
Congenital immunity errors and predisposition to SARS-Cov-2 infection and COVID-19 severity. International coordinated action of complete exomic sequencing
Rebeca Pérez de Diego
Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
SARS-Cov-2 infection is mild or even asymptomatic in many patients, but can cause severe disease (COVID-19), primarily in patients older than 50 years, especially those with comorbidities. There are, however, young patients without risk factors with severe forms of the disease. Some of these patients may have congenital immunity errors (diseases often with incomplete penetrance). The main objective is the sequencing of the complete exome, using massive sequencing techniques, in patients under 50 years of age in Spain without comorbidities or risk factors. The project is part of an international consortium, of which we are one of the participating groups (https://www.cvidhge.com), in which the information will be shared to carry out population studies that allow progress towards precision medicine in patients with COVID-19.
COV20/01333 Instituto de Investigación Sanitaria del Hospital Universitario La Paz (IdiPAZ), Madrid No Multicentric COVID-19 disease characterization Registro
Congenital immunity errors and predisposition to SARS-Cov-2 infection and COVID-19 severity. International coordinated action of complete exomic sequencing
José Carlos Rodríguez Gallego
Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC)
Organization: Multicentric
Clinical trial: No
Topic call: COVID-19 disease characterization
SARS-Cov-2 infection is mild or even asymptomatic in many patients, but can cause severe disease (COVID-19), primarily in patients older than 50 years, especially those with comorbidities. There are, however, young patients without risk factors with severe forms of the disease. Some of these patients may have congenital immunity errors (diseases often with incomplete penetrance). The main objective is the sequencing of the complete exome, using massive sequencing techniques, in patients under 50 years of age in Spain without comorbidities or risk factors. The project is part of an international consortium, of which we are one of the participating groups (https://www.cvidhge.com), in which the information will be shared to carry out population studies that allow progress towards precision medicine in patients with COVID-19.
COV20/01334 Fundación del Instituto de Investigación Sanitaria de Canarias (FIISC) No Multicentric COVID-19 disease characterization Registro

This website uses cookies, and the limited processing of your personal data to function.
By using the site you are agreeing to this as outlined in our Privacy Notice.

Back to top